Glut4 Antibody (1G9)

Images

 
Sandwich ELISA: Glut4 Antibody (1G9) [H00006517-M10] - Detection limit for recombinant GST tagged SLC2A4 is 1 ng/ml as a capture antibody.

Product Details

Summary
Product Discontinued
View other related Glut4 Primary Antibodies

Order Details


    • Catalog Number
      H00006517-M10
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Glut4 Antibody (1G9) Summary

Immunogen
SLC2A4 (NP_001033 467 a.a. - 509 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC2A4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glut4 Antibody (1G9)

  • Glut4
  • GLUT-4
  • GLUT4Glucose transporter type 4, insulin-responsive
  • insulin-responsive glucose transporter type 4
  • SLC2A4
  • solute carrier family 2 (facilitated glucose transporter), member 4
  • solute carrier family 2, facilitated glucose transporter member 4

Background

The oxidation of glucose represents a major source of metabolic energy for mammalian cells. However, because the plasma membrane is impermeable to polar molecules such as glucose, the cellular uptake of this important nutrient is accomplished by membrane-associated carrier proteins that bind and transfer it across the lipid bilayer. The subcellular localization of the GLUT4 (muscle/fat) isoform changes in response to insulin, and this isoform is responsible for most of the insulin-stimulated uptake of glucose that occurs in muscle and adipose tissue (1). Insulin stimulates glucose uptake in fat and muscle by mobilizing the GLUT4 glucose transporter. GLUT4 is sequestered intracellularly in the absence of insulin, and is redistributed to the plasma membrane within minutes of insulin stimulation (2). The translocation of GLUT4 may involve signalling pathways that are both independent of and dependent on phosphatidylinositol-3-OH kinase (PI(3)K). This translocation also requires the actin cytoskeleton, and the rapid movement of GLUT4 along linear tracks may be mediated by molecular motors (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
AF6386
Species: Hu
Applications: WB, IP
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB1415
Species: Hu
Applications: Flow, CyTOF-ready, ICC
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP2-00597
Species: Hu, Mk
Applications: WB, Flow, ICC/IF
H00144195-R01
Species: Hu

Publications for Glut4 Antibody (H00006517-M10) (0)

There are no publications for Glut4 Antibody (H00006517-M10).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glut4 Antibody (H00006517-M10) (0)

There are no reviews for Glut4 Antibody (H00006517-M10). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glut4 Antibody (H00006517-M10) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glut4 Products

Bioinformatics Tool for Glut4 Antibody (H00006517-M10)

Discover related pathways, diseases and genes to Glut4 Antibody (H00006517-M10). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glut4 Antibody (H00006517-M10)

Discover more about diseases related to Glut4 Antibody (H00006517-M10).
 

Pathways for Glut4 Antibody (H00006517-M10)

View related products by pathway.

PTMs for Glut4 Antibody (H00006517-M10)

Learn more about PTMs related to Glut4 Antibody (H00006517-M10).
 

Research Areas for Glut4 Antibody (H00006517-M10)

Find related products by research area.

Blogs on Glut4.

Glucose Transporter 4 (GLUT4, SLC2A4)
GLUT4 is an insulin-sensitive glucose transporter that facilitates insulin-stimulated glucose uptake in adipose tissue, skeletal muscle, and cardiac tissues that specifically express this protein. It is a twelve transmembrane domain multi-pass protein...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glut4 Antibody (1G9) and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC2A4
Entrez
Uniprot