Glut4 Antibody (1F1)

Images

 
Sandwich ELISA: Glut4 Antibody (1F1) [H00006517-M04] - Detection limit for recombinant GST tagged SLC2A4 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1F1
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Glut4 Antibody (1F1) Summary

Immunogen
SLC2A4 (NP_001033 467 a.a. - 509 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
Specificity
SLC2A4 - solute carrier family 2 (facilitated glucose transporter), member 4 (1F1)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
SLC2A4
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Reviewed Applications
Read 1 Review rated 5
using
H00006517-M04 in the following applications:

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glut4 Antibody (1F1)

  • Glut4
  • GLUT-4
  • GLUT4Glucose transporter type 4, insulin-responsive
  • insulin-responsive glucose transporter type 4
  • SLC2A4
  • solute carrier family 2 (facilitated glucose transporter), member 4
  • solute carrier family 2, facilitated glucose transporter member 4

Background

This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NB110-39113
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
AF6386
Species: Hu
Applications: WB, IP
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
MAB1415
Species: Hu
Applications: Flow, CyTOF-ready, ICC
AF2850
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP2-22127
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-87487
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58707
Species: Hu
Applications: WB, ICC/IF
NBP2-00597
Species: Hu, Mk
Applications: WB, Flow, ICC/IF
H00144195-R01
Species: Hu

Publications for Glut4 Antibody (H00006517-M04) (0)

There are no publications for Glut4 Antibody (H00006517-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Glut4 Antibody (H00006517-M04) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.
We have 1 review tested in 1 application: WB.

Reviews using H00006517-M04:
Filter by Applications
WB
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Western Blot Glut4 H00006517-M04
Enlarge
reviewed by:
Zhiwei Zhou
WB Human 08/26/2013
View

Summary

ApplicationWestern Blot
Sample TestedHuman
SpeciesHuman

Blocking

Blocking Details5%milk

Primary Anitbody

Dilution Ratio1ug/ml

Secondary Antibody

Secondary DescriptionGoat anti-rabbit IgF-HRP
Secondary Manufacturer Cat#Promega
Secondary Concentration1/10,000

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glut4 Antibody (H00006517-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glut4 Products

Bioinformatics Tool for Glut4 Antibody (H00006517-M04)

Discover related pathways, diseases and genes to Glut4 Antibody (H00006517-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glut4 Antibody (H00006517-M04)

Discover more about diseases related to Glut4 Antibody (H00006517-M04).
 

Pathways for Glut4 Antibody (H00006517-M04)

View related products by pathway.

PTMs for Glut4 Antibody (H00006517-M04)

Learn more about PTMs related to Glut4 Antibody (H00006517-M04).
 

Research Areas for Glut4 Antibody (H00006517-M04)

Find related products by research area.

Blogs on Glut4.

Glucose Transporter 4 (GLUT4, SLC2A4)
GLUT4 is an insulin-sensitive glucose transporter that facilitates insulin-stimulated glucose uptake in adipose tissue, skeletal muscle, and cardiac tissues that specifically express this protein. It is a twelve transmembrane domain multi-pass protein...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Zhiwei Zhou
08/26/2013
Application: WB
Species: Human

Bioinformatics

Gene Symbol SLC2A4
Entrez
Uniprot