Glut4 Antibody (1F12)


Western Blot: Glut4 Antibody (1F12) [H00006517-M02] - Analysis of SLC2A4 expression in transfected 293T cell line by SLC2A4 monoclonal antibody (M02), clone 1F12.Lane 1: SLC2A4 transfected lysate(54.8 KDa).Lane 2: more
Sandwich ELISA: Glut4 Antibody (1F12) [H00006517-M02] - Detection limit for recombinant GST tagged SLC2A4 is approximately 0.3ng/ml as a capture antibody.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA

Order Details

Glut4 Antibody (1F12) Summary

SLC2A4 (NP_001033 467 a.a. - 509 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. RVPETRGRTFDQISAAFHRTPSLLEQEVKPSTELEYLGPDEND
SLC2A4 - solute carrier family 2 (facilitated glucose transporter), member 4 (1F12)
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glut4 Antibody (1F12)

  • Glut4
  • GLUT-4
  • GLUT4Glucose transporter type 4, insulin-responsive
  • insulin-responsive glucose transporter type 4
  • SLC2A4
  • solute carrier family 2 (facilitated glucose transporter), member 4
  • solute carrier family 2, facilitated glucose transporter member 4


This gene is a member of the solute carrier family 2 (facilitated glucose transporter) family and encodes a protein that functions as an insulin-regulated facilitative glucose transporter. In the absence of insulin, this integral membrane protein is sequestered within the cells of muscle and adipose tissue. Within minutes of insulin stimulation, the protein moves to the cell surface and begins to transport glucose across the cell membrane. Mutations in this gene have been associated with noninsulin-dependent diabetes mellitus (NIDDM). [provided by RefSeq]


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC
Species: Hu, Mu
Applications: WB, IP
Species: Hu
Applications: WB, IP
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICC
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mk
Applications: WB, Flow, ICC/IF
Species: Hu

Publications for Glut4 Antibody (H00006517-M02) (0)

There are no publications for Glut4 Antibody (H00006517-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glut4 Antibody (H00006517-M02) (0)

There are no reviews for Glut4 Antibody (H00006517-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glut4 Antibody (H00006517-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Glut4 Products

Bioinformatics Tool for Glut4 Antibody (H00006517-M02)

Discover related pathways, diseases and genes to Glut4 Antibody (H00006517-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glut4 Antibody (H00006517-M02)

Discover more about diseases related to Glut4 Antibody (H00006517-M02).

Pathways for Glut4 Antibody (H00006517-M02)

View related products by pathway.

PTMs for Glut4 Antibody (H00006517-M02)

Learn more about PTMs related to Glut4 Antibody (H00006517-M02).

Research Areas for Glut4 Antibody (H00006517-M02)

Find related products by research area.

Blogs on Glut4.

Glucose Transporter 4 (GLUT4, SLC2A4)
GLUT4 is an insulin-sensitive glucose transporter that facilitates insulin-stimulated glucose uptake in adipose tissue, skeletal muscle, and cardiac tissues that specifically express this protein. It is a twelve transmembrane domain multi-pass protein...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Glut4 Antibody (1F12) and receive a gift card or discount.


Gene Symbol SLC2A4