Glucosylceramidase/GBA Antibody (2E2.) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Glucosylceramidase/GBA Primary Antibodies

Order Details


    • Catalog Number
      H00002629-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Glucosylceramidase/GBA Antibody (2E2.) [PerCP] Summary

Immunogen
GBA (NP_000148 146 a.a. - 235 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. SYFSEEGIGYNIIRVPMASCDFSIRTYTYADTPDDFQLHNFSLPEEDTKLKIPLIHRALQLAQRPVSLLASPWTSPTWLKTNGAVNGKGS
Specificity
GBA - glucosidase, beta; acid (includes glucosylceramidase)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GBA
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glucosylceramidase/GBA Antibody (2E2.) [PerCP]

  • Acid beta-glucosidase
  • Alglucerase
  • beta-glucocerebrosidase
  • D-glucosyl-N-acylsphingosine glucohydrolase
  • EC 3.2.1.45
  • GBA
  • GBA1
  • GC
  • GCB
  • GLUC
  • glucosidase, beta, acid
  • glucosidase, beta; acid (includes glucosylceramidase)
  • Glucosylceramidase
  • Imiglucerase
  • lysosomal glucocerebrosidase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-31369
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15771
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37422
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
AF5787
Species: Hu, Mu
Applications: WB, IHC, ICC
NBP1-26380
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-91642
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-12505
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP2-45889
Species: Hu
Applications: WB, IHC
NB300-268
Species: Hu, Mu, Bv, Ce
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF5525
Species: Hu
Applications: WB, IHC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP1-84505
Species: Hu
Applications: IHC, IHC-P
AF842
Species: Hu
Applications: WB
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF1513
Species: Mu
Applications: WB, Simple Western, Flow, IHC, IP, CyTOF-ready
NBP1-26612
Species: Hu
Applications: IP (-), WB
H00002629-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Glucosylceramidase/GBA Antibody (H00002629-M01PCP) (0)

There are no publications for Glucosylceramidase/GBA Antibody (H00002629-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucosylceramidase/GBA Antibody (H00002629-M01PCP) (0)

There are no reviews for Glucosylceramidase/GBA Antibody (H00002629-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Glucosylceramidase/GBA Antibody (H00002629-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glucosylceramidase/GBA Products

Bioinformatics Tool for Glucosylceramidase/GBA Antibody (H00002629-M01PCP)

Discover related pathways, diseases and genes to Glucosylceramidase/GBA Antibody (H00002629-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucosylceramidase/GBA Antibody (H00002629-M01PCP)

Discover more about diseases related to Glucosylceramidase/GBA Antibody (H00002629-M01PCP).
 

Pathways for Glucosylceramidase/GBA Antibody (H00002629-M01PCP)

View related products by pathway.

PTMs for Glucosylceramidase/GBA Antibody (H00002629-M01PCP)

Learn more about PTMs related to Glucosylceramidase/GBA Antibody (H00002629-M01PCP).
 

Research Areas for Glucosylceramidase/GBA Antibody (H00002629-M01PCP)

Find related products by research area.

Blogs on Glucosylceramidase/GBA

There are no specific blogs for Glucosylceramidase/GBA, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucosylceramidase/GBA Antibody (2E2.) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol GBA
Entrez