Glucose 6 Phosphate Dehydrogenase Antibody (3H5)

Images

 
Western Blot: Glucose 6 Phosphate Dehydrogenase Antibody (3H5) [H00002539-M01] - G6PD monoclonal antibody (M01), clone 3H5. Analysis of G6PD expression in human kidney.
Sandwich ELISA: Glucose 6 Phosphate Dehydrogenase Antibody (3H5) [H00002539-M01] - Detection limit for recombinant GST tagged G6PD is 3 ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Glucose 6 Phosphate Dehydrogenase Antibody (3H5) Summary

Immunogen
G6PD (AAH00337 406 a.a. - 515 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TKKPGMFFNPEESELDLTYGNRYKNVKLPDAYERLILDVFCGSQMHFVRSDELREAWRIFTPLLHQIELEKPKPIPYIYGSRGPTEADELMKRVGFQYEGTYKWVNPHKL
Marker
Cytosol Marker
Specificity
G6PD - glucose-6-phosphate dehydrogenase (3H5)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
G6PD
Purity
Ascites
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against recombinant protein on ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Ascites

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Glucose 6 Phosphate Dehydrogenase Antibody (3H5)

  • G6PD
  • G6PD1EC 1.1.1.49
  • glucose-6-phosphate dehydrogenase

Background

This gene encodes glucose-6-phosphate dehydrogenase. This protein is a cytosolic enzyme encoded by a housekeeping X-linked gene whose main function is to produce NADPH, a key electron donor in the defense against oxidizing agents and in reductive biosynthetic reactions. G6PD is remarkable for its genetic diversity. Many variants of G6PD, mostly produced from missense mutations, have been described with wide ranging levels of enzyme activity and associated clinical symptoms. G6PD deficiency may cause neonatal jaundice, acute hemolysis, or severe chronic non-spherocytic hemolytic anemia. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-31589
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02615
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-32398
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-54755
Species: Hu
Applications: WB
NBP2-34980
Species: Hu
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC-P
NBP1-80533
Species: Mu
Applications: WB
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-32108
Species: Hu, Rt
Applications: WB, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NB300-221
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Eq, Ha, Op, Pm, Sh, Ze
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IP
NB400-114
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01) (0)

There are no publications for Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01) (0)

There are no reviews for Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Glucose 6 Phosphate Dehydrogenase Products

Bioinformatics Tool for Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01)

Discover related pathways, diseases and genes to Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01)

Discover more about diseases related to Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01).
 

Pathways for Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01)

View related products by pathway.

PTMs for Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01)

Learn more about PTMs related to Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01).
 

Research Areas for Glucose 6 Phosphate Dehydrogenase Antibody (H00002539-M01)

Find related products by research area.

Blogs on Glucose 6 Phosphate Dehydrogenase

There are no specific blogs for Glucose 6 Phosphate Dehydrogenase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Glucose 6 Phosphate Dehydrogenase Antibody (3H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol G6PD
OMIM