Recombinant Human Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein

Order Details


    • Catalog Number
      H00002799-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein Summary

Description
Glucosamine (N-acetyl)-6-Sulfatase/GNS (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MRLLPLAPGRLRRGSPRHLPSCSPALLLLVLGGCLGVFGVAAGTRRPNVVLLLTDDQDEVLGGMTPLKKTKALIGEMGMTFSSAYVPSALCCPSRASILTGKYPHNHHVVNNTLEGNCSSKSWQKIQEPNTFPAILRSMCGYQTFFAGKYLNEYGAPDAGGLEHVPLGWSYWYALEKNSKYYNYTLSINGKARKHGENYSVDYLTDVLANVSLDFLDYKSNFEPFFMMIATPAPHSPWTAAPQYQKAFQNVFAPRNKNFNIHGTNKHWLIRQAKTPMTNSSIQFLDNAFRKRWQTLLSVDDLVEKLVKRLEFTGELNNTYIFYTSDNGYHTGQFSLPIDKRQLYEFDIKVPLLVRGPGIKPNQTSKMLVANIDLGPTILDIAGYDLNKTQMDGMSLLPILRGASNLTWRSDVLVEYQGEGRNVTDPTCPSLSPGVSQCFPDCVCEDAYNNTYACVRTMSALWNLQYCEFDDQEVFVEVYNLTADPDQITNIAKTIDPELLGKMNYRLMMLQSCSGPTCRTPGVFDPGYRFDPRLMFSNRGSVRTRRFSKHLL
Protein/Peptide Type
Recombinant Protein
Gene
GNS

Applications/Dilutions

Application Notes
Western blot, ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein

  • EC 3.1.6
  • EC 3.1.6.14
  • G6Sglucosamine-6-sulfatase
  • glucosamine (N-acetyl)-6-sulfatase
  • Glucosamine6Sulfatase
  • Glucosamine-6-Sulfatase
  • GNS
  • MGC21274
  • N-acetylglucosamine-6-sulfatase

Background

The product of this gene is a lysosomal enzyme found in all cells. It is involved in the catabolism of heparin, heparan sulphate, and keratan sulphate. Deficiency of this enzyme results in the accumulation of undegraded substrate and the lysosomal storage disorder mucopolysaccharidosis type IIID (Sanfilippo D syndrome). Mucopolysaccharidosis type IIID is the least common of the four subtypes of Sanfilippo syndrome. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
MAB4415
Species: Hu
Applications: WB, ICC
H00347527-B01P
Species: Hu
Applications: WB, ELISA
H00003845-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-92190
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-33498
Species: Hu
Applications: IHC, IHC-P
AF3159
Species: Mu
Applications: WB, IHC
NBP1-57033
Species: Hu
Applications: WB
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP2-12902
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56705
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF3184
Species: Hu, Mu
Applications: WB, Simple Western, ICC
NBP2-16610
Species: Hu
Applications: WB
NB600-534
Species: Hu, Po, Vi
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, RIA

Publications for Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01) (0)

There are no publications for Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01) (0)

There are no reviews for Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Glucosamine (N-acetyl)-6-Sulfatase/GNS Products

Bioinformatics Tool for Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01)

Discover related pathways, diseases and genes to Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01)

Discover more about diseases related to Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01).
 

Pathways for Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01)

View related products by pathway.

PTMs for Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01)

Learn more about PTMs related to Glucosamine (N-acetyl)-6-Sulfatase/GNS Recombinant Protein (H00002799-P01).

Blogs on Glucosamine (N-acetyl)-6-Sulfatase/GNS

There are no specific blogs for Glucosamine (N-acetyl)-6-Sulfatase/GNS, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Glucosamine (N-acetyl)-6-Sulfatase/GNS Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GNS
Entrez