GLTSCR1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GLTSCR1 Antibody [NBP2-30603] - Staining of human cell line SiHa shows positivity in nucleus but excluded from the nucleoli.
Immunohistochemistry-Paraffin: GLTSCR1 Antibody [NBP2-30603] - Staining of human heart muscle shows strong nuclear positivity in myocytes.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLTSCR1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ASSLDADEDGPMPSRNRPPIKTYEARSRIGLKLKIKQEAGLSKVVHNTALDPVHQPPPPPATLKVA
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLTSCR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
GLTSCR1 Protein (NBP2-30603PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (89%), Rat (89%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLTSCR1 Antibody

  • Glioma Tumor Suppressor Candidate Region Gene 1 Protein
  • Glioma Tumor Suppressor Candidate Region Gene 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF3296
Species: Hu, Mu, Rt
Applications: WB
NB500-704
Species: ChHa, Hu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-80905
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-56599
Species: Hu, Mu, Rt(-)
Applications: Flow-IC, Flow, ICC/IF, WB
NBP2-31896
Species: Hu
Applications: IHC, IHC-Fr, IHC-P, WB
NBP2-33283
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67674
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NBP1-28457
Species: Hu
Applications: Flow, IHC, IHC-P
NBP2-58795
Species: Hu
Applications: ICC/IF, WB
NB100-74611
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP1-30475
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-01020
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB100-143
Species: Ha, Hu, Ma, Mu, Pm
Applications: ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-P, IP, ISH, KO, PAGE, WB
NB100-57495
Species: Hu
Applications: IP, WB
H00004595-M01
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, KD, WB
NBP2-48732
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-19676
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-77359
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-50163
Species: Hu, Mu
Applications: ChIP, CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IP, KO, WB
NBP1-49599
Species: Mu
Applications: ELISA, IP, WB

Publications for GLTSCR1 Antibody (NBP2-30603) (0)

There are no publications for GLTSCR1 Antibody (NBP2-30603).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLTSCR1 Antibody (NBP2-30603) (0)

There are no reviews for GLTSCR1 Antibody (NBP2-30603). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GLTSCR1 Antibody (NBP2-30603) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GLTSCR1 Products

Bioinformatics Tool for GLTSCR1 Antibody (NBP2-30603)

Discover related pathways, diseases and genes to GLTSCR1 Antibody (NBP2-30603). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLTSCR1 Antibody (NBP2-30603)

Discover more about diseases related to GLTSCR1 Antibody (NBP2-30603).
 

Pathways for GLTSCR1 Antibody (NBP2-30603)

View related products by pathway.

PTMs for GLTSCR1 Antibody (NBP2-30603)

Learn more about PTMs related to GLTSCR1 Antibody (NBP2-30603).

Blogs on GLTSCR1

There are no specific blogs for GLTSCR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLTSCR1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLTSCR1
Uniprot