GLRB Antibody

Images

 
Western Blot: GLRB Antibody [NBP2-84981] - Host: Rabbit. Target Name: GLRB. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLRB Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human GLRB. Peptide sequence: LILISLWVEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPANSTSNI The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GLRB
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GLRB Antibody

  • beta subunit
  • Glycine receptor 58 kDa subunit
  • glycine receptor, beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-113
Species: Hu, Mu, Rt
Applications: IHC, IHC-Fr, IP, WB
NBP2-03449
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-86653
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-85533
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
MAB7848
Species: Hu
Applications: IHC, WB
H00002742-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-12251
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
640-A3
Species: Mu
Applications: Bind
H00008001-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP1-89765
Species: Hu
Applications: IHC, IHC-P
NBP1-59008
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NB100-757
Species: Hu
Applications: ChIP, IHC, IHC-P, WB
NB100-1538
Species: Ha, Hu, Rt
Applications: IHC, IHC-P, IP, PEP-ELISA, WB
NBP1-90003
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-84981
Species: Hu
Applications: WB

Publications for GLRB Antibody (NBP2-84981) (0)

There are no publications for GLRB Antibody (NBP2-84981).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLRB Antibody (NBP2-84981) (0)

There are no reviews for GLRB Antibody (NBP2-84981). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GLRB Antibody (NBP2-84981) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLRB Products

Bioinformatics Tool for GLRB Antibody (NBP2-84981)

Discover related pathways, diseases and genes to GLRB Antibody (NBP2-84981). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLRB Antibody (NBP2-84981)

Discover more about diseases related to GLRB Antibody (NBP2-84981).
 

Pathways for GLRB Antibody (NBP2-84981)

View related products by pathway.

PTMs for GLRB Antibody (NBP2-84981)

Learn more about PTMs related to GLRB Antibody (NBP2-84981).
 

Research Areas for GLRB Antibody (NBP2-84981)

Find related products by research area.

Blogs on GLRB

There are no specific blogs for GLRB, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLRB Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLRB