![Western Blot: GLRB Antibody [NBP2-84981] - Host: Rabbit. Target Name: GLRB. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml](http://images.novusbio.com/fullsize2/GLRB-Antibody-Western-Blot-NBP2-84981-img0001.jpg "Western Blot: GLRB Antibody [NBP2-84981] - Host: Rabbit. Target Name: GLRB. Sample Tissue: Human Jurkat Whole Cell lysates. Antibody Dilution: 1ug/ml")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human GLRB. Peptide sequence: LILISLWVEEAYSKEKSSKKGKGKKKQYLCPSQQSAEDLARVPANSTSNI The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | GLRB |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Immunogen affinity purified |
![Immunohistochemistry-Paraffin: GlyT2/SLC6A5 Antibody [NBP2-86653] - Rabbit Anti-SLC6A5 Antibody. Formalin Fixed Paraffin Embedded Tissue: Human Adult heart. Observed Staining: Cytoplasmic. Primary Antibody Concentration: 1:600. Secondary Antibody: Donkey anti-Rabbit-Cy2/3. Secondary Antibody](http://images.novusbio.com/images2/GlyT2-SLC6A5-Antibody-Immunohistochemistry-Paraffin-NBP2-86653-img0001.jpg)
![Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653] - WB Suggested Anti-SLC6A5 antibody Titration: 1 ug/mL. Sample Type: Human heart](http://images.novusbio.com/images2/GlyT2-SLC6A5-Antibody-Western-Blot-NBP2-86653-img0003.jpg)
![Western Blot: GlyT2/SLC6A5 Antibody [NBP2-86653] - Host: Rabbit. Target Name: SLC6A5. Sample Type: COLO205 Whole cell lysates. Antibody Dilution: 1.0ug/ml](http://images.novusbio.com/images2/GlyT2-SLC6A5-Antibody-Western-Blot-NBP2-86653-img0002.jpg)
![Immunocytochemistry/Immunofluorescence: GARS Antibody [NBP1-85533] - Immunofluorescent staining of human cell line U-2 OS shows localization to cytosol. Antibody staining is shown in green.](http://images.novusbio.com/images2/GARS-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-85533-img0006.jpg)
![Immunohistochemistry-Paraffin: GARS Antibody [NBP1-85533] - Staining of human cerebral cortex, liver, pancreas and testis using Anti-GARS antibody NBP1-85533 (A) shows similar protein distribution across tissues to independent antibody NBP1-85534 (B).](http://images.novusbio.com/images2/GARS-Antibody-Immunohistochemistry-Paraffin-NBP1-85533-img0007.jpg)
![Western Blot: GARS Antibody [NBP1-85533] - Analysis using Anti-GARS antibody NBP1-85533 (A) shows similar pattern to independent antibody NBP1-85534 (B).](http://images.novusbio.com/images2/GARS-Antibody-Western-Blot-NBP1-85533-img0008.jpg)
![Western Blot: SLC6A2/NET/Noradrenaline transporter Antibody [NBP3-12251] - Rat brain cortical membranes. 1:250 antibody in DiluObuffer. Apparent MW is 80 KDa.](http://images.novusbio.com/images2/SLC6A2-NET-Noradrenaline-transporter-Antibody-Western-Blot-NBP3-12251-img0001.jpg)
![Immunohistochemistry-Paraffin: SLC6A2/NET/Noradrenaline transporter Antibody [NBP3-12251] - Rat brain. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 40X magnfication.](http://images.novusbio.com/images2/SLC6A2-NET-Noradrenaline-transporter-Antibody-Immunohistochemistry-Paraffin-NBP3-12251-img0002.jpg)
![Immunohistochemistry-Paraffin: SLC6A2/NET/Noradrenaline transporter Antibody [NBP3-12251] - Rat brain. 1:100 dilution in IHC blocking buffer. DAB (brown) staining and Hematoxylin QS (blue) counterstain. 5X magnfication.](http://images.novusbio.com/images2/SLC6A2-NET-Noradrenaline-transporter-Antibody-Immunohistochemistry-Paraffin-NBP3-12251-img0003.jpg)
![Immunohistochemistry-Paraffin: Neurobeachin Antibody [NBP1-90003] - Staining of human kidney shows strong cytoplasmic positivity in renal tubules.](http://images.novusbio.com/images2/Neurobeachin-Antibody-Immunohistochemistry-Paraffin-NBP1-90003-img0005.jpg)
![Immunohistochemistry-Paraffin: Neurobeachin Antibody [NBP1-90003] - Staining of human pancreas.](http://images.novusbio.com/images2/Neurobeachin-Antibody-Immunohistochemistry-Paraffin-NBP1-90003-img0007.jpg)
![Immunohistochemistry-Paraffin: Neurobeachin Antibody [NBP1-90003] - Staining of human testis.](http://images.novusbio.com/images2/Neurobeachin-Antibody-Immunohistochemistry-Paraffin-NBP1-90003-img0008.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for GLRB Antibody (NBP2-84981)Discover more about diseases related to GLRB Antibody (NBP2-84981).
| Pathways for GLRB Antibody (NBP2-84981)View related products by pathway.
|
PTMs for GLRB Antibody (NBP2-84981)Learn more about PTMs related to GLRB Antibody (NBP2-84981).
| Research Areas for GLRB Antibody (NBP2-84981)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | GLRB |
![Western Blot: Glycine Receptor Alpha 1 Antibody [NB300-113] - Rat spinal cord lysate (SC) showing specific immunolabeling of the ~48 kDa alpha 1- and alpha 2-subunits of the glycine receptor. Immunolabeling was absent from a rat hippocampal lysate (H), as the glycine receptor is not expressed in the hippocampus.](http://images.novusbio.com/images2/Glycine-Receptor-Alpha-1-Antibody-Western-Blot-NB300-113-img0005.jpg)
![Western Blot: Glycine Receptor Alpha 1 Antibody [NB300-113] - Rat spinal cord showing specific immunolabeling of the ~48k a1- and a2-subunits of the glycine receptor. The labeling was absent from a Rat hippocampal (hipp) lysate as the glycine receptor is not expressed in the hippocampus.](http://images.novusbio.com/images2/Glycine-Receptor-Alpha-1-Antibody-Western-Blot-NB300-113-img0003.jpg)
![Western Blot: Glycine Receptor Alpha 1 Antibody [NB300-113] - Western blot of 10 ug of rat spinal cord. The antibody is specific for the ~48 kDa a1- and a2-subunitsof the glycine receptor.](http://images.novusbio.com/images2/Glycine-Receptor-Alpha-1-Antibody-Western-Blot-NB300-113-img0004.jpg)
![Flow Cytometry: Gephyrin/GPHN Antibody (3B6) [NBP2-03449] - Analysis of Jurkat cells, using anti-Gephyrin antibody, (Red), compared to a nonspecific negative control antibody (Blue).](http://images.novusbio.com/images2/Gephyrin-GPHN-Antibody-(3B6)-Flow-Cytometry-NBP2-03449-img0010.jpg)
![Flow Cytometry: Gephyrin/GPHN Antibody (3B6) [NBP2-03449] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Gephyrin antibody, and then analyzed by flow cytometry.](http://images.novusbio.com/images2/Gephyrin-GPHN-Antibody-(3B6)-Flow-Cytometry-NBP2-03449-img0011.jpg)
![Immunocytochemistry/Immunofluorescence: Gephyrin/GPHN Antibody (3B6) [NBP2-03449] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Gephyrin.](http://images.novusbio.com/images2/Gephyrin-GPHN-Antibody-(3B6)-Immunocytochemistry-Immunofluorescence-NBP2-03449-img0012.jpg)
![Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Western-Blot-NBP1-81838-img0006.jpg)
![Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Immunohistochemistry-NBP1-81838-img0008.jpg)
![Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Immunohistochemistry-Paraffin-NBP1-81838-img0009.jpg)
![Immunohistochemistry-Paraffin: GluR2 Antibody [NBP1-89765] - Staining of human cerebral cortex shows high expression.](http://images.novusbio.com/images2/GluR2-Antibody-Immunohistochemistry-Paraffin-NBP1-89765-img0004.jpg)
![Immunohistochemistry-Paraffin: GluR2 Antibody [NBP1-89765] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/images2/GluR2-Antibody-Immunohistochemistry-Paraffin-NBP1-89765-img0005.jpg)
![Immunohistochemistry-Paraffin: GluR2 Antibody [NBP1-89765] - Analysis in human cerebral cortex and liver tissues using NBP1-89765 antibody. Corresponding GRIA2 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/images2/GluR2-Antibody-Immunohistochemistry-Paraffin-NBP1-89765-img0007.jpg)
![Immunohistochemistry-Paraffin: NPY1R Antibody [NBP1-59008] - Human liver.](http://images.novusbio.com/images2/NPY1R-Antibody-Immunohistochemistry-Paraffin-NBP1-59008-img0007.jpg)
![Immunohistochemistry-Paraffin: NPY1R Antibody [NBP1-59008] - Human Testis Tissue, 5ug/ml](http://images.novusbio.com/images2/NPY1R-Antibody-Immunohistochemistry-Paraffin-NBP1-59008-img0008.jpg)
![Immunohistochemistry-Paraffin: NPY1R Antibody [NBP1-59008] - Human Gut Tissue, primary dilution 10ug/ml and 2ug/ml. Secondary goat anti-rabbit Cy3 at 1:500.](http://images.novusbio.com/images2/NPY1R-Antibody-Immunohistochemistry-Paraffin-NBP1-59008-img0009.jpg)
![Immunohistochemistry-Paraffin: NRSF Antibody [NB100-757] - FFPE section of human breast carcinoma. Antibody: Affinity purified rabbit anti- REST used at a dilution of 1:1,000 (1ug/ml). Detection: DAB Counterstain: IHC Hematoxylin (blue).](http://images.novusbio.com/images2/NRSF-Antibody-Immunohistochemistry-Paraffin-NB100-757-img0010.jpg)
![Western Blot: NRSF Antibody [NB100-757] - Detection of Human REST by Western Blot. Samples: Whole cell lysate (50 ug) from HeLa, 293T, and Jurkat cells prepared using NETN lysis buffer. Antibodies: Affinity purified rabbit anti-REST antibody NB100-757 used for WB at 0.1 ug/ml. Detection: Chemiluminescence with an exposure time of 30 seconds.](http://images.novusbio.com/images2/NRSF-Antibody-Western-Blot-NB100-757-img0009.jpg)
![Immunohistochemistry-Paraffin: NPY5R Antibody [NB100-1538] - Staining of Human Intestine. Antibody at 3.8 ug/mL. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/images/NPY5R-Antibody-Immunohistochemistry-Paraffin-NB100-1538-img0001.jpg)
![Western Blot: NPY5R Antibody [NB100-1538] - Staining of Human Brain lysate (35 ug protein in RIPA buffer). Antibody at 0.3 ug/mL. Primary incubation was 1 hour. Detected by chemiluminescence.](http://images.novusbio.com/images/NPY5R-Antibody-Western-Blot-NB100-1538-img0002.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")