GLI-3 Antibody (2C9) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related GLI-3 Primary Antibodies

Order Details


    • Catalog Number
      H00002737-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GLI-3 Antibody (2C9) [PE] Summary

Immunogen
GLI3 (NP_000159, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFA
Specificity
GLI3 (2C9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GLI3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GLI-3 Antibody (2C9) [PE]

  • ACLS
  • ACLSPAPAPHS
  • ADD
  • Bph
  • GCPS
  • GLI family zinc finger 3
  • GLI3 form of 190 kDa
  • GLI3 full length protein
  • GLI3
  • GLI-3
  • GLI3-190
  • GLI3FL
  • GLI-Kruppel family member GLI3
  • glioma-associated oncogene family zinc finger 3
  • Greig cephalopolysyndactyly syndrome
  • oncogene GLI3
  • PAP-A
  • PAPA1
  • PAPB
  • PAPBDNA-binding protein
  • Pdn
  • PHS
  • PPDIV
  • Xt
  • zinc finger protein GLI3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-23602
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-47914
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-57016
Species: Hu
Applications: WB
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-118
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
1705-HH/CF
Species: Hu, Mu
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
MAB6240
Species: Hu
Applications: WB, IHC
NBP2-24614
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
NBP2-24763
Species: Hu, Pm
Applications: WB, IHC-P
NB100-55268
Species: Hu
Applications: WB, IP
NBP1-87343
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-77933
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-36999
Species: Hu, Mu, Rt
Applications: PEP-ELISA
NBP2-38621
Species: Hu
Applications: ICC/IF, IHC, IHC-P
423-F8/CF
Species: Hu, Mu
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P

Publications for GLI-3 Antibody (H00002737-M01PE) (0)

There are no publications for GLI-3 Antibody (H00002737-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI-3 Antibody (H00002737-M01PE) (0)

There are no reviews for GLI-3 Antibody (H00002737-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GLI-3 Antibody (H00002737-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLI-3 Products

Bioinformatics Tool for GLI-3 Antibody (H00002737-M01PE)

Discover related pathways, diseases and genes to GLI-3 Antibody (H00002737-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLI-3 Antibody (H00002737-M01PE)

Discover more about diseases related to GLI-3 Antibody (H00002737-M01PE).
 

Pathways for GLI-3 Antibody (H00002737-M01PE)

View related products by pathway.

PTMs for GLI-3 Antibody (H00002737-M01PE)

Learn more about PTMs related to GLI-3 Antibody (H00002737-M01PE).
 

Research Areas for GLI-3 Antibody (H00002737-M01PE)

Find related products by research area.

Blogs on GLI-3

There are no specific blogs for GLI-3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLI-3 Antibody (2C9) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol GLI3
Entrez