Home » GLI-3 » GLI-3 Antibodies » GLI-3 Antibody (2C9) [DyLight 755]

GLI-3 Antibody (2C9) [DyLight 755]

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related GLI-3 Primary Antibodies

Order Details


    • Catalog Number
      H00002737-M01IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GLI-3 Antibody (2C9) [DyLight 755] Summary

Immunogen
GLI3 (NP_000159, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFA
Specificity
GLI3 (2C9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GLI3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GLI-3 Antibody (2C9) [DyLight 755]

  • ACLS
  • ACLSPAPAPHS
  • ADD
  • Bph
  • GCPS
  • GLI family zinc finger 3
  • GLI3 form of 190 kDa
  • GLI3 full length protein
  • GLI3
  • GLI-3
  • GLI3-190
  • GLI3FL
  • GLI-Kruppel family member GLI3
  • glioma-associated oncogene family zinc finger 3
  • Greig cephalopolysyndactyly syndrome
  • oncogene GLI3
  • PAP-A
  • PAPA1
  • PAPB
  • PAPBDNA-binding protein
  • Pdn
  • PHS
  • PPDIV
  • Xt
  • zinc finger protein GLI3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

GLI-1 Antibody
NB600-600
Immunohistochemistry-Paraffin: GLI-1 Antibody [NB600-600] - IHC-P analysis of a formalin fixed paraffin embedded mouse brain section using GLI-1 antibody at 1:600 dilution.
Flow (Intracellular): GLI-1 Antibody [NB600-600] - intracellular staining for GLI-1 in untreated human B cell lines (BCWM.1, MWCL-1 and RPCI-WM1) using anti-GLI-1 antibody. Rabbit IgG Isotype Control (Cat# NBP2-36463) was used as a negative control. Image courtesy of Sherine Elsawa, Northern Illinois University.
(22 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
GLI-2 Antibody
NB600-874
Western Blot: GLI-2 Antibody [NB600-874] - Analysis of Gli-2 protein in rat testes (lane 1) and human HEK293 (lane 2) whole cell lysates (arrowhead). See Ruppert et al for testing conditions. Each lane contains approximately 35 ug of lysate. Primary antibody was used at a 1:400 dilution in 5% BLOTTO in PBS overnight at 4C. The membrane was washed and reacted with a 1:10,000 dilution of IRDye 800 conjugated Gt-a-Rabbit IgG [H&L] MX10 for 45 min at room temperature (800 nm channel, green).
Immunohistochemistry: GLI-2 Antibody [NB600-874] - Staining of tumor cells in human breast tissue. Tissue was formalin-fixed and paraffin embedded. Brown color indicates presence of protein, blue color shows cell nuclei.
Flow (Intracellular): GLI-2 Antibody [NB600-874] - intracellular staining for GLI-2 in untreated human B cell lines (BCWM.1, MWCL-1 and RPCI-WM1) using anti-GLI-2 antibody. Rabbit IgG Isotype Control (Cat# NBP2-36463) was used as a negative control. Image courtesy of Sherine Elsawa, Northern Illinois University.
(3 Publications)
Species: Hu, Mu, Pm
Applications: WB, ELISA, IHC, IHC-P, ChIP, Flow-IC
POR/Cytochrome
P450 Reductase Antibo ...
NBP1-47914
Western Blot: POR/Cytochrome P450 Reductase Antibody (3F10) [NBP1-47914] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Cytochrome P450 Reductase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Cytochrome P450 Reductase.
Immunocytochemistry/Immunofluorescence: POR/Cytochrome P450 Reductase Antibody (3F10) [NBP1-47914] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Cytochrome P450 Reductase.
Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody (3F10) [NBP1-47914] - Staining of paraffin-embedded Human prostate tissue using anti-Cytochrome P450 Reductase mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Blood group H
inhibitor Overexpress ...
H00002523-T01
FUT1 transfected lysate.
Lane 1: FUT1 transfected lysate (40.26 KDa) Lane 2: Non-transfected lysate.
Species: Hu
HFE Antibody (1G12)
H00003077-M01
Western Blot: HFE Antibody (1G12) [H00003077-M01] - HFE monoclonal antibody (M01), clone 1G12. Analysis of HFE expression in A-431.
Immunocytochemistry/Immunofluorescence: HFE Antibody (1G12) [H00003077-M01] - Analysis of monoclonal antibody to HFE on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HFE Antibody (1G12) [H00003077-M01] - Analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.Lane 1: HFE transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF
Patched 1/PTCH
Antibody (5c7)
NBP1-47945
Western Blot: Patched 1/PTCH Antibody (5c7) [NBP1-47945] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Patched 1 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Patched 1.
Immunocytochemistry: Patched 1/PTCH Antibody (5c7) [NBP1-47945] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Patched 1.
Immunohistochemistry-Paraffin: Patched 1/PTCH Antibody (5c7) [NBP1-47945] - Human endometrium tissue.
(2 Publications)
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
Smoothened Antibody
NBP2-24543
Western Blot: Smoothened Antibody [NBP2-24543] - Analysis in human heart lysate in the 1) absence and 2) presence of immunizing peptide using SMO antibody at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Smoothened Antibody [NBP2-24543] - Immunohistochemical analysis of Smoothened in formalin-fixed paraffin-embedded human brain tissue using an isotype control antibody (top) and Smoothened antibody (bottom) at 10 ug/ml.
(4 Publications)
Species: Hu, Mu, Pm
Applications: WB, IHC-P
SMOX Antibody
NBP2-55775
Western Blot: SMOX Antibody [NBP2-55775] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: SMOX Antibody [NBP2-55775] - Staining of human cell line A549 shows localization to nucleoplasm, nuclear membrane & vesicles.
Species: Hu
Applications: WB, ICC/IF
Prostatic Acid
Phosphatase/ACPP Anti ...
MAB6240
Western blot shows lysates of human prostate tissue. PVDF Membrane was probed with 2 µg/mL of Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB6240) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF007). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB6240) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: WB, IHC
PAG3 Antibody
NBP2-24614
Western Blot: PAG3 Antibody [NBP2-24614] - Analysis of ASAP2 in human brain lysate using 1) preimmune sera at 1:5000 and 2) protein A purified this antibody. 1.0 ug/ml.
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Reg3A Antibody
NBP2-24763
Western Blot: Reg3a Antibody [NBP2-24763] - Human intestine lysate probed with REG3A antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Reg3a Antibody [NBP2-24763] - Formalin-fixed, paraffin-embedded human intestine stained with REG3A antibody (2.5 ug/ml), peroxidase-conjugate and DAB chromogen.
(1 Publication)
Species: Hu, Pm
Applications: WB, IHC-P
PAPOLA Antibody
NB100-55268
Western Blot: PAPOLA Antibody [NB100-55268] - Detection of Human PAPOLA on HeLa whole cell lysate using NB100-55268. PAPOLA was also immunoprecipitated by rabbit anti-PAPOLA antibody NB100-55267.
(1 Publication)
Species: Hu
Applications: WB, IP
MRPS30 Antibody
NBP1-87343
Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
ASAP1 [p Tyr782]
Antibody
NBP1-77933
Immunocytochemistry/Immunofluorescence: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Analysis of phosphorylated ASAP1present in mouse NIH3T3 cells transfected with activated Src. Specific staining is not present when antibody is pre-incubated with the immunizing peptide prior to reaction with cells.
Immunohistochemistry: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Used at 20 g/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows moderate intracellular positive staining in epidermal keratinocytes in human skin at 40X. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain. Personal Communi-cation, Tina Roush, LifeSpanBiosciences, Seattle, WA.
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
TUSC2 Antibody
NBP1-36999
TUSC2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA
PDAP1 Antibody
NBP2-38621
Immunocytochemistry/Immunofluorescence: PDAP1 Antibody [NBP2-38621] - Staining of human cell line U-251 MG shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: PDAP1 Antibody [NBP2-38621] - Staining of human tonsil shows cytoplasmic positivity mainly in germinal center cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Smoothened Antibody
NBP2-24543
Western Blot: Smoothened Antibody [NBP2-24543] - Analysis in human heart lysate in the 1) absence and 2) presence of immunizing peptide using SMO antibody at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Smoothened Antibody [NBP2-24543] - Immunohistochemical analysis of Smoothened in formalin-fixed paraffin-embedded human brain tissue using an isotype control antibody (top) and Smoothened antibody (bottom) at 10 ug/ml.
(4 Publications)
Species: Hu, Mu, Pm
Applications: WB, IHC-P
GLI-3 Antibody
(2C9) [DyLight 755]
H00002737-M01IR
GLI-3 Antibody (2C9) [DyLight 755]
Species: Hu
Applications: WB, ELISA, ICC/IF, PLA

Publications for GLI-3 Antibody (H00002737-M01IR) (0)

There are no publications for GLI-3 Antibody (H00002737-M01IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI-3 Antibody (H00002737-M01IR) (0)

There are no reviews for GLI-3 Antibody (H00002737-M01IR). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GLI-3 Antibody (H00002737-M01IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLI-3 Antibody (2C9) [DyLight 755] Products

Related Products by Gene

ACPP, ASAP1, ASAP2, FGF8, FUT1, GLI1, GLI2, HFE, IHH, MRPS30, PAPOLA, PDAP1, POR, PTCH1, REG3A, SHH, SMO, SMOOTHENED, SMOX, TUSC2

Bioinformatics Tool for GLI-3 Antibody (H00002737-M01IR)

Discover related pathways, diseases and genes to GLI-3 Antibody (H00002737-M01IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLI-3 Antibody (H00002737-M01IR)

Discover more about diseases related to GLI-3 Antibody (H00002737-M01IR).
 

Pathways for GLI-3 Antibody (H00002737-M01IR)

View related products by pathway.

PTMs for GLI-3 Antibody (H00002737-M01IR)

Learn more about PTMs related to GLI-3 Antibody (H00002737-M01IR).
 

Research Areas for GLI-3 Antibody (H00002737-M01IR)

Find related products by research area.

Blogs on GLI-3

There are no specific blogs for GLI-3, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLI-3 Antibody (2C9) [DyLight 755] and receive a gift card or discount.


Bioinformatics

Gene Symbol GLI3
Entrez