Home » GLI-3 » GLI-3 Antibodies » GLI-3 Antibody (2C9) [DyLight 755]

GLI-3 Antibody (2C9) [DyLight 755]

 Submit a Review

Images

 

Product Details

Summary
Product Discontinued
View other related GLI-3 Primary Antibodies

Order Details


    • Catalog Number
      H00002737-M01IR
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GLI-3 Antibody (2C9) [DyLight 755] Summary

Immunogen
GLI3 (NP_000159, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MEAQSHSSTTTEKKKVENSIVKCSTRTDVSEKAVASSTTSNEDESPGQTYHRERRNAITMQPQNVQGLSKVSEEPSTSSDERASLIKKEIHGSLPHVAEPSVPYRGTVFA
Specificity
GLI3 (2C9)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GLI3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Proximity Ligation Assay

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
50mM Sodium Borate
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

Dylight (R) is a trademark of Thermo Fisher Scientific Inc. and its subsidiaries. This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GLI-3 Antibody (2C9) [DyLight 755]

  • ACLS
  • ACLSPAPAPHS
  • ADD
  • Bph
  • GCPS
  • GLI family zinc finger 3
  • GLI3 form of 190 kDa
  • GLI3 full length protein
  • GLI3
  • GLI-3
  • GLI3-190
  • GLI3FL
  • GLI-Kruppel family member GLI3
  • glioma-associated oncogene family zinc finger 3
  • Greig cephalopolysyndactyly syndrome
  • oncogene GLI3
  • PAP-A
  • PAPA1
  • PAPB
  • PAPBDNA-binding protein
  • Pdn
  • PHS
  • PPDIV
  • Xt
  • zinc finger protein GLI3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Sonic Hedgehog/Shh
[Unconjugated]
461-SH/CF
1 μg/lane of Recombinant Mouse Sonic Hedgehog/Shh, N-Terminus was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
Recombinant Mouse Sonic Hedgehog/Shh, N-Terminus (Catalog # 461-SH/CF) induces alkaline phosphatase production by the C3H10T1/2 mouse embryonic fibroblast cell line. The ED50 for this effect is 0.6‑3 μg/mL.
(25 Publications)
Species: Mu
GLI-1 Antibody
NB600-600
Immunohistochemistry-Paraffin: GLI-1 Antibody [NB600-600] - IHC-P analysis of a formalin fixed paraffin embedded mouse brain section using GLI-1 antibody at 1:600 dilution.
Flow (Intracellular): GLI-1 Antibody [NB600-600] - intracellular staining for GLI-1 in untreated human B cell lines (BCWM.1, MWCL-1 and RPCI-WM1) using anti-GLI-1 antibody. Rabbit IgG Isotype Control (Cat# NBP2-36463) was used as a negative control. Image courtesy of Sherine Elsawa, Northern Illinois University.
(25 Publications)
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
GLI-2 Antibody
NBP2-23602
Immunocytochemistry/Immunofluorescence: GLI-2 Antibody [NBP2-23602] - Gli2 antibody was tested in HeLa cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and Dylight 550 (red). An antibody dilution of 1:50 was used. Image objective 40x.
Immunohistochemistry: GLI-2 Antibody [NBP2-23602] - Analysis of Gli2 in mouse heart.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
POR/Cytochrome
P450 Reductase Antibo ...
NBP1-47914
Western Blot: POR/Cytochrome P450 Reductase Antibody (3F10) [NBP1-47914] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Cytochrome P450 Reductase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Cytochrome P450 Reductase.
Immunocytochemistry/Immunofluorescence: POR/Cytochrome P450 Reductase Antibody (3F10) [NBP1-47914] - Staining of COS7 cells transiently transfected by pCMV6-ENTRY Cytochrome P450 Reductase.
Immunohistochemistry-Paraffin: POR/Cytochrome P450 Reductase Antibody (3F10) [NBP1-47914] - Staining of paraffin-embedded Human prostate tissue using anti-Cytochrome P450 Reductase mouse monoclonal antibody.
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Blood group H
inhibitor Antibody
NBP1-57016
Western Blot: Blood group H inhibitor Antibody [NBP1-57016] - Human Heart lysate, concentration 0.2-1 ug/ml.
Species: Hu
Applications: WB
HFE Antibody (1G12)
H00003077-M01
Western Blot: HFE Antibody (1G12) [H00003077-M01] - HFE monoclonal antibody (M01), clone 1G12. Analysis of HFE expression in A-431.
Immunocytochemistry/Immunofluorescence: HFE Antibody (1G12) [H00003077-M01] - Analysis of monoclonal antibody to HFE on HeLa cell. Antibody concentration 10 ug/ml.
Western Blot: HFE Antibody (1G12) [H00003077-M01] - Analysis of HFE expression in transfected 293T cell line by HFE monoclonal antibody (M01), clone 1G12.Lane 1: HFE transfected lysate(40.1 KDa).Lane 2: Non-transfected lysate.
(2 Reviews)
(1 Publication)
Species: Hu
Applications: WB, ELISA, ICC/IF
Patched 1/PTCH
Antibody
NB200-118
Western Blot: Patched 1 Antibody [NB200-118]-Analysis of Human PTCH1 in Fetal brain Lysate with anti huPTCH1 at a 1:500 dilution.
(3 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Indian Hedgehog/Ihh
1705-HH/CF
Indian Hedgehog/Ihh
(6 Publications)
Species: Hu, Mu
Smoothened Antibody
NBP2-24543
Western Blot: Smoothened Antibody [NBP2-24543] - Analysis in human heart lysate in the 1) absence and 2) presence of immunizing peptide using SMO antibody at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Smoothened Antibody [NBP2-24543] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse lung using Smoothened antibody at 10ug/ml concentration. The signal was detected using HRP conjugated anti-Rabbit secondary antibody with DAB detection method and nuclei were counterstained using hematoxylin. This Smoothened antibody generated primarily a membranous staining in the cells of alveolar epithelium. The background signal observed in this test is potentially arising from the use of high concentration of the antibody.
Immunohistochemistry-Paraffin: Smoothened Antibody [NBP2-24543] - Immunohistochemical analysis of Smoothened in formalin-fixed paraffin-embedded human brain tissue using an isotype control antibody (top) and Smoothened antibody (bottom) at 10 ug/ml.
(4 Publications)
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P
SMOX Antibody
NBP2-55775
Western Blot: SMOX Antibody [NBP2-55775] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/Immunofluorescence: SMOX Antibody [NBP2-55775] - Staining of human cell line A549 shows localization to nucleoplasm, nuclear membrane & vesicles.
Species: Hu
Applications: WB, ICC/IF
Prostatic Acid
Phosphatase/ACPP Anti ...
AF6240
Western blot shows lysates of LNCaP human prostate cancer cell line. PVDF Membrane was probed with 1 µg/mL of Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) followed by HRP-conjugated Anti-Sheep IgG Secondary Antibody (Catalog # HAF016). A specific band was detected for Prostatic Acid Phosphatase/ACPP at approximately 50-55 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 8.
Prostatic Acid Phosphatase/ACPP was detected in immersion fixed paraffin-embedded sections of human prostate using Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) at 3 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Sheep HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS019) and counterstained with hemotoxylin (blue). Specific staining was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Recombinant Human Prostatic Acid Phosphatase/ACPP protein was serially diluted 2-fold and captured by Mouse Anti-Human Prostatic Acid Phosphatase/ACPP Monoclonal Antibody (Catalog # MAB62401) coated on a Clear Polystyrene Microplate (Catalog # DY990). Sheep Anti-Human Prostatic Acid Phosphatase/ACPP Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6240) was biotinylated and incubated with the protein captured on the plate. Detection of the standard curve was achieved by incubating Streptavidin-HRP (Catalog # DY998) followed by Substrate Solution (Catalog # DY999) and stopping the enzymatic reaction with Stop Solution (Catalog # DY994).
Species: Hu
Applications: WB, ELISA, IHC
PAG3 Antibody
NBP2-24614
Western Blot: PAG3 Antibody [NBP2-24614] - Analysis of ASAP2 in human brain lysate using 1) preimmune sera at 1:5000 and 2) protein A purified this antibody. 1.0 ug/ml.
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Reg3A Antibody
NBP2-24763
Western Blot: Reg3a Antibody [NBP2-24763] - Human intestine lysate probed with REG3A antibody at 2 ug/ml. Goat anti-rabbit Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunohistochemistry-Paraffin: Reg3a Antibody [NBP2-24763] - Formalin-fixed, paraffin-embedded human intestine stained with REG3A antibody (2.5 ug/ml), peroxidase-conjugate and DAB chromogen.
(1 Publication)
Species: Hu, Pm
Applications: WB, IHC-P
PAPOLA Knockout
293T Cell Lysate
NBP2-65899
PAPOLA Knockout 293T Cell Lysate
Species: Hu
MRPS30 Antibody
NBP1-87343
Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: MRPS30 Antibody [NBP1-87343] - Staining of human liver shows moderate granular cytoplasmic positivity in hepatocytes.
Western Blot: MRPS30 Antibody [NBP1-87343] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG
Species: Hu, Rt
Applications: WB, IHC, IHC-P
ASAP1 [p Tyr782]
Antibody
NBP1-77933
Immunocytochemistry/Immunofluorescence: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Analysis of phosphorylated ASAP1present in mouse NIH3T3 cells transfected with activated Src. Specific staining is not present when antibody is pre-incubated with the immunizing peptide prior to reaction with cells.
Immunohistochemistry: ASAP1 [p Tyr782] Antibody [NBP1-77933] - Used at 20 g/ml to detect signal in a variety of tissues including multi-human, multi-brain and multi-cancer slides. This image shows moderate intracellular positive staining in epidermal keratinocytes in human skin at 40X. Tissue was formalin-fixed and paraffin embedded. The image shows localization of the antibody as the precipitated red signal, with a hematoxylin purple nuclear counterstain. Personal Communication, Tina Roush, LifeSpanBiosciences, Seattle, WA.
Species: Hu, Mu, Rt, Bv, Ca, Ch, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
TUSC2 Antibody
NBP1-36999
TUSC2 Antibody
(1 Publication)
Species: Hu, Mu, Rt
Applications: PEP-ELISA
PDAP1 Knockout
293T Cell Lysate
NBP2-65749
PDAP1 Knockout 293T Cell Lysate
Species: Hu
FGF-8
[Unconjugated]
423-F8
Recombinant Human/Mouse FGF-8b (Catalog # 423-F8) stimulates cell proliferation in the NR6R‑3T3 mouse fibroblast cell line. The ED50 for this effect is 6.5-40 ng/mL in the presence of 1 μg/mL heparin.
1 μg/lane of Recombinant Human/Mouse FGF-8b was resolved with SDS-PAGE under reducing (R) conditions and visualized by silver staining, showing a single band at 23 kDa.
(2 Reviews)
(34 Publications)
Species: Hu, Mu
Smoothened Antibody
NBP2-24543
Western Blot: Smoothened Antibody [NBP2-24543] - Analysis in human heart lysate in the 1) absence and 2) presence of immunizing peptide using SMO antibody at 0.1 ug/ml.
Immunohistochemistry-Paraffin: Smoothened Antibody [NBP2-24543] - IHC analysis of a formalin fixed and paraffin embedded tissue section of mouse lung using Smoothened antibody at 10ug/ml concentration. The signal was detected using HRP conjugated anti-Rabbit secondary antibody with DAB detection method and nuclei were counterstained using hematoxylin. This Smoothened antibody generated primarily a membranous staining in the cells of alveolar epithelium. The background signal observed in this test is potentially arising from the use of high concentration of the antibody.
Immunohistochemistry-Paraffin: Smoothened Antibody [NBP2-24543] - Immunohistochemical analysis of Smoothened in formalin-fixed paraffin-embedded human brain tissue using an isotype control antibody (top) and Smoothened antibody (bottom) at 10 ug/ml.
(4 Publications)
Species: Hu, Mu, Pm
Applications: WB, IHC, IHC-P

Publications for GLI-3 Antibody (H00002737-M01IR) (0)

There are no publications for GLI-3 Antibody (H00002737-M01IR).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI-3 Antibody (H00002737-M01IR) (0)

There are no reviews for GLI-3 Antibody (H00002737-M01IR). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GLI-3 Antibody (H00002737-M01IR) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GLI-3 Products

Bioinformatics Tool for GLI-3 Antibody (H00002737-M01IR)

Discover related pathways, diseases and genes to GLI-3 Antibody (H00002737-M01IR). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLI-3 Antibody (H00002737-M01IR)

Discover more about diseases related to GLI-3 Antibody (H00002737-M01IR).
 

Pathways for GLI-3 Antibody (H00002737-M01IR)

View related products by pathway.

PTMs for GLI-3 Antibody (H00002737-M01IR)

Learn more about PTMs related to GLI-3 Antibody (H00002737-M01IR).
 

Research Areas for GLI-3 Antibody (H00002737-M01IR)

Find related products by research area.

Blogs on GLI-3

There are no specific blogs for GLI-3, but you can read our latest blog posts.

Contact Information

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLI-3 Antibody (2C9) [DyLight 755] and receive a gift card or discount.


Bioinformatics

Gene Symbol GLI3
Entrez