GLI-1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GLI-1 Antibody [NBP2-68877] - Staining of human cell line RH-30 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GLI-1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PCLDFDSPTHSTGQLKAQLVCNYVQSQQELLWEGGGREDAPAQEPSYQSPKFLGGSQVSPSRAKAPVNTYGPGFGPNLPNHKSGSYP
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GLI1
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
ICC/IF Fixation/Permeabilization: PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Protein A purified

Alternate Names for GLI-1 Antibody

  • GLI family zinc finger 1
  • GLI1
  • GLI-1
  • glioma-associated oncogene family zinc finger 1
  • glioma-associated oncogene homolog 1 (zinc finger protein)
  • Glioma-associated oncogene
  • GLIzinc finger protein GLI1
  • Oncogene GLI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-71662
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF3635
Species: Mu
Applications: WB, IHC
NLS2666
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Ha, Mk, Rb
Applications: ICC/IF, IHC, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
NLS2666
Species: Hu, Mu, Rt, Po, Bv, Ca, Eq, Ha, Mk, Rb
Applications: ICC/IF, IHC, IHC-P
MAB1249
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow
NBP1-87384
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002158-M01
Species: Hu
Applications: WB, ELISA, IP, RNAi
AF482
Species: Mu
Applications: WB, IHC
NBP2-80532
Species: Hu, Mk
Applications: WB, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84814
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-68877
Species: Hu
Applications: ICC/IF

Publications for GLI-1 Antibody (NBP2-68877) (0)

There are no publications for GLI-1 Antibody (NBP2-68877).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GLI-1 Antibody (NBP2-68877) (0)

There are no reviews for GLI-1 Antibody (NBP2-68877). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GLI-1 Antibody (NBP2-68877) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GLI-1 Products

Bioinformatics Tool for GLI-1 Antibody (NBP2-68877)

Discover related pathways, diseases and genes to GLI-1 Antibody (NBP2-68877). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GLI-1 Antibody (NBP2-68877)

Discover more about diseases related to GLI-1 Antibody (NBP2-68877).
 

Pathways for GLI-1 Antibody (NBP2-68877)

View related products by pathway.

PTMs for GLI-1 Antibody (NBP2-68877)

Learn more about PTMs related to GLI-1 Antibody (NBP2-68877).
 

Research Areas for GLI-1 Antibody (NBP2-68877)

Find related products by research area.

Blogs on GLI-1

There are no specific blogs for GLI-1, but you can read our latest blog posts.
Recombinant Monoclonal Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GLI-1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GLI1
Novus 100% Guarantee