Recombinant Human GITR/TNFRSF18 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related GITR/TNFRSF18 Peptides and Proteins

Order Details


    • Catalog Number
      H00008784-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human GITR/TNFRSF18 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 26-115 of Human TNFRSF18 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDC

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TNFRSF18

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GITR/TNFRSF18 Protein

  • Activation-inducible TNFR family receptor
  • AITR
  • AITRTNF receptor superfamily activation-inducible protein
  • CD357 antigen
  • CD357
  • GITR
  • GITR-D
  • GITRtumor necrosis factor receptor superfamily member 18
  • Glucocorticoid-induced TNFR-related protein
  • TNFRSF18
  • tumor necrosis factor receptor superfamily, member 18

Background

TNFRSF18 - tumor necrosis factor receptor superfamily, member 18

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NB100-39002
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00003669-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF3388
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
MAB342
Species: Hu
Applications: WB, AgAct
NBP1-42795
Species: Hu
Applications: WB, Flow, Func, IHC, IHC-Fr, IP, CyTOF-ready
NBP2-29323
Species: Hu, Mu, Rt, Bv, Ca, Ch, Xp
H00008784-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01) (0)

There are no publications for GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01) (0)

There are no reviews for GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GITR/TNFRSF18 Products

Bioinformatics Tool for GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01)

Discover related pathways, diseases and genes to GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01)

Discover more about diseases related to GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01).
 

Pathways for GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01)

View related products by pathway.

PTMs for GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01)

Learn more about PTMs related to GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01).
 

Research Areas for GITR/TNFRSF18 Partial Recombinant Protein (H00008784-Q01)

Find related products by research area.

Blogs on GITR/TNFRSF18

There are no specific blogs for GITR/TNFRSF18, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GITR/TNFRSF18 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TNFRSF18
Entrez