Recombinant Human GIF Protein

Images

 

Product Details

Summary
Product Discontinued
View other related GIF Peptides and Proteins

Order Details


    • Catalog Number
      H00002694-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human GIF Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-417 of Human GIF full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMILNEIKQGKFHNPMSIAQILPSLKGKTYLDVPQVTCSPDHEVQPTLPSNPGPGPTSASNITVIYTINNQLRGVELLFNETINVSVKSGSVLLVVLEEAQRKNPMFKFETTMTSWGLVVSSINNIAENVNHKTYWQFLSGVTPLNEGVADYIPFNHEHITANFTQY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GIF

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GIF Protein

  • gastric intrinsic factor (vitamin B synthesis)
  • GIF
  • IF
  • IFIntrinsic factor
  • IFMH
  • IFMHgastric intrinsic factor
  • INF
  • TCN3

Background

This gene is a member of the cobalamin transport protein family. It encodes a glycoprotein secreted by parietal cells of the gastric mucosa and is required for adequate absorption of vitamin B12. Vitamin B12 is necessary for erythrocyte maturation and mutations in this gene may lead to congenital pernicious anemia. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89772
Species: Hu
Applications: IHC, IHC-P
AF7895
Species: Hu
Applications: WB, IHC
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF3700
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
H00006947-M12
Species: Hu
Applications: WB, ELISA, IHC-P, IP
8457-AS
Species: Hu
NB100-62239
Species: Hu
Applications: ELISA, IHC-P, RIA
MAB9350
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-02450
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33320
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-91761
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00002694-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for GIF Recombinant Protein (H00002694-P01) (0)

There are no publications for GIF Recombinant Protein (H00002694-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GIF Recombinant Protein (H00002694-P01) (0)

There are no reviews for GIF Recombinant Protein (H00002694-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GIF Recombinant Protein (H00002694-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GIF Products

Bioinformatics Tool for GIF Recombinant Protein (H00002694-P01)

Discover related pathways, diseases and genes to GIF Recombinant Protein (H00002694-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GIF Recombinant Protein (H00002694-P01)

Discover more about diseases related to GIF Recombinant Protein (H00002694-P01).
 

Pathways for GIF Recombinant Protein (H00002694-P01)

View related products by pathway.

PTMs for GIF Recombinant Protein (H00002694-P01)

Learn more about PTMs related to GIF Recombinant Protein (H00002694-P01).

Blogs on GIF

There are no specific blogs for GIF, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GIF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GIF
Entrez