GHITM Antibody


Western Blot: GHITM Antibody [NBP1-68914] - Mouse Liver lysate, concentration 0.2-1 ug/ml.

Product Details

Product Discontinued
View other related GHITM Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GHITM Antibody Summary

Synthetic peptides corresponding to Ghitm (growth hormone inducible transmembrane protein) The peptide sequence was selected from the middle region of Ghitm. Peptide sequence WVTIGATFAAMIGAGMLVHSISYEQSPGPKHLAWMLHSGVMGAVVAPLTI.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Ghitm and was validated on Western blot.
Theoretical MW
37 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GHITM Antibody

  • Dermal papilla-derived protein 2
  • DKFZp566C0746
  • FLJ26584
  • growth hormone inducible transmembrane protein
  • growth hormone-inducible transmembrane protein
  • HSPC282
  • Mitochondrial morphology and cristae structure 1
  • PTD010
  • TMBIM5My021
  • transmembrane BAX inhibitor motif containing 5
  • Transmembrane BAX inhibitor motif-containing protein 5


Ghitm is required for the mitochondrial tubular network and cristae organization. Ghitm is involved in apoptotic release of cytochrome c.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, Flow, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC-P
Species: Hu, Mu, Rt, Po, Ch, Ha, Pl, Pm
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, IHC, CyTOF-ready, Neut
Species: Hu, Mu, Rt, Ca, Eq, Pm
Applications: WB, Simple Western, ELISA, Flow, Func, ICC/IF, IHC, IHC-P, IP, In vitro, CyTOF-ready, Flow-IC
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu, Mu, Rt, Ca, Eq
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P

Publications for GHITM Antibody (NBP1-68914) (0)

There are no publications for GHITM Antibody (NBP1-68914).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GHITM Antibody (NBP1-68914) (0)

There are no reviews for GHITM Antibody (NBP1-68914). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GHITM Antibody (NBP1-68914) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GHITM Products

Bioinformatics Tool for GHITM Antibody (NBP1-68914)

Discover related pathways, diseases and genes to GHITM Antibody (NBP1-68914). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GHITM Antibody (NBP1-68914)

Discover more about diseases related to GHITM Antibody (NBP1-68914).

Pathways for GHITM Antibody (NBP1-68914)

View related products by pathway.

PTMs for GHITM Antibody (NBP1-68914)

Learn more about PTMs related to GHITM Antibody (NBP1-68914).

Blogs on GHITM

There are no specific blogs for GHITM, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GHITM Antibody and receive a gift card or discount.


Gene Symbol GHITM