GGA3 Antibody

Images

 
Western Blot: GGA3 Antibody [NBP1-55315] - Titration: 0.2-1 ug/ml, Positive Control: Human Thymus.

Product Details

Summary
Product Discontinued
View other related GGA3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-55315
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GGA3 Antibody Summary

Immunogen
Synthetic peptides corresponding to GGA3(golgi associated, gamma adaptin ear containing, ARF binding protein 3) The peptide sequence was selected from the N terminal of GGA3. Peptide sequence AKLLKSKNPDDLQEANKLIKSMVKEDEARIQKVTKRLHTLEEVNNNV
Clonality
Polyclonal
Host
Rabbit
Gene
GGA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GGA3 and was validated on Western blot.
Theoretical MW
78 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GGA3 Antibody

  • ADP-ribosylation factor-binding protein GGA3
  • golgi associated, gamma adaptin ear containing, ARF binding protein 3
  • golgi-associated, gamma adaptin ear containing, ARF binding protein 3
  • KIAA0154Golgi-localized, gamma ear-containing, ARF-binding protein 3

Background

This gene encodes a member of the Golgi-localized, gamma adaptin ear-containing, ARF-binding (GGA) family. This family includes ubiquitous coat proteins that regulate the trafficking of proteins between the trans-Golgi network and the lysosome. These prot

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-14047
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-58645
Species: Hu
Applications: WB, ICC/IF
MAB931
Species: Hu, Mu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP2-13075
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
NBP2-41263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF6567
Species: Hu, Mu
Applications: WB, IHC
NBP1-89490
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00006430-B01P
Species: Hu, Rt
Applications: WB, ICC/IF, IHC-P
H00009146-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
H00008458-M06
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-45897
Species: Hu
Applications: WB, IHC
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
AF5699
Species: Hu, Mu
Applications: WB, IHC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
MAB5526
Species: Hu, Mu
Applications: WB
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
NBP1-55315
Species: Hu
Applications: WB

Publications for GGA3 Antibody (NBP1-55315) (0)

There are no publications for GGA3 Antibody (NBP1-55315).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GGA3 Antibody (NBP1-55315) (0)

There are no reviews for GGA3 Antibody (NBP1-55315). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GGA3 Antibody (NBP1-55315) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GGA3 Products

Bioinformatics Tool for GGA3 Antibody (NBP1-55315)

Discover related pathways, diseases and genes to GGA3 Antibody (NBP1-55315). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GGA3 Antibody (NBP1-55315)

Discover more about diseases related to GGA3 Antibody (NBP1-55315).
 

Pathways for GGA3 Antibody (NBP1-55315)

View related products by pathway.

PTMs for GGA3 Antibody (NBP1-55315)

Learn more about PTMs related to GGA3 Antibody (NBP1-55315).
 

Research Areas for GGA3 Antibody (NBP1-55315)

Find related products by research area.

Blogs on GGA3

There are no specific blogs for GGA3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GGA3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GGA3
Uniprot