Recombinant Human GFM2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GFM2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 681-779 of Human GFM2 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:ADKQVLEPLMNLEVTVARDYLSPVLADLAQRRGNIQEIQTRQDNKVVIGFVPLAEIMGYSTVLRTLTSGSATFALELSTYQAMNPQDQNTLLNRRSGLT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GFM2

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GFM2 Protein

  • EFG2MSTP027
  • Elongation factor G 2, mitochondrial
  • Elongation factor G2
  • G elongation factor, mitochondrial 2
  • mitochondrial
  • MRRF2
  • MST027

Background

Eukaryotes contain two protein translational systems, one in the cytoplasm and one in the mitochondria. Mitochondrial translation is crucial for maintaining mitochondrial function and mutations in this system lead to a breakdown in the respiratory chain-oxidative phosphorylation system and to impaired maintenance of mitochondrial DNA. This gene encodes one of mitochondrial translation elongation factors. Its role in the regulation of normal mitochondrial function and in different disease states attributed to mitochondrial dysfunction is not known. Alternative splicing results in at least three transcript variants encoding distinct isoforms. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83997
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45434
Species: Hu
Applications: WB, IHC
H00004205-M02
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-80306
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-41211
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IF
NBP1-91996
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-36751
Species: Hu
Applications: WB, ICC/IF, IHC
AF4764
Species: Hu
Applications: WB, IHC, ICC
NB100-1903
Species: Hu, Mu, Rt, Po, Ca, Ha, Pm
Applications: WB, B/N, Flow, ICC/IF, IHC-P, IP
NLS1513
Species: Hu
Applications: IHC-P
NBP1-91444
Species: Hu
Applications: WB

Publications for GFM2 Partial Recombinant Protein (H00084340-Q01) (0)

There are no publications for GFM2 Partial Recombinant Protein (H00084340-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFM2 Partial Recombinant Protein (H00084340-Q01) (0)

There are no reviews for GFM2 Partial Recombinant Protein (H00084340-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GFM2 Partial Recombinant Protein (H00084340-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GFM2 Products

Bioinformatics Tool for GFM2 Partial Recombinant Protein (H00084340-Q01)

Discover related pathways, diseases and genes to GFM2 Partial Recombinant Protein (H00084340-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GFM2 Partial Recombinant Protein (H00084340-Q01)

Discover more about diseases related to GFM2 Partial Recombinant Protein (H00084340-Q01).
 

Pathways for GFM2 Partial Recombinant Protein (H00084340-Q01)

View related products by pathway.

Blogs on GFM2

There are no specific blogs for GFM2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFM2 Antibody
NBP2-16646
Furin Antibody
NB100-1903

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GFM2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GFM2