GFER/ALR Recombinant Protein Antigen

Images

 
There are currently no images for GFER/ALR Protein (NBP1-90187PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

GFER/ALR Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GFER.

Source: E. coli

Amino Acid Sequence: QQDMAQFIHLFSKFYPCEECAEDLRKRLCRNHPDTRTRACFTQWLCHLHNEVNRKLGKPDFDCSKVDERWRDGWKDGSCD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
GFER
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90187.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for GFER/ALR Recombinant Protein Antigen

  • ALR
  • ALRFAD-linked sulfhydryl oxidase ALR
  • Augmenter of liver regeneration
  • EC 1.8.3.2
  • ERV1 homolog
  • ERV1
  • ERV1hepatopoietin protein
  • erv1-like growth factor
  • GFER
  • growth factor, augmenter of liver regeneration
  • growth factor, erv1 (S. cerevisiae)-like (augmenter of liver regeneration)
  • Hepatopoietin
  • HERV1
  • HERV1hepatic regenerative stimulation substance
  • HPO
  • HPO1
  • HPO2
  • HSS
  • truncated augmenter of liver regeneration

Background

The hepatotrophic factor designated augmenter of liver regeneration (ALR) is thought to be one of the factorsresponsible for the extraordinary regenerative capacity of mammalian liver. It has also been called hepaticregenerative stimulation substance (HSS). The gene resides on chromosome 16 in the interval containing the locus forpolycystic kidney disease (PKD1). The putative gene product is 42% similar to the scERV1 protein of yeast. The yeastscERV1 gene had been found to be essential for oxidative phosphorylation, the maintenance of mitochondrial genomes,and the cell division cycle. The human gene is both the structural and functional homolog of the yeast scERV1 gene.(provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-05584
Species: Mu, Rt
Applications: WB
NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, KO, Simple Western, WB
NBP1-81763
Species: Hu
Applications: IHC,  IHC-P
NBP2-92630
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB200-197
Species: Hu, Mu
Applications: IP, WB
294-HG
Species: Hu
Applications: BA
NBP1-87757
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00060485-M02
Species: Hu, Mu, Ye
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-99532
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P
NBP2-67471
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56503
Species: Dr, Hu, Mu, Rb, Rt
Applications: Flow-CS, Flow-IC, Flow, IB, ICC/IF, IHC,  IHC-P, Simple Western, WB
NBP3-03473
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KO, WB
NBP1-82648
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-48017
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-87833
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-24915
Species: Bv, Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-90187PEP
Species: Hu
Applications: AC

Publications for GFER/ALR Protein (NBP1-90187PEP) (0)

There are no publications for GFER/ALR Protein (NBP1-90187PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GFER/ALR Protein (NBP1-90187PEP) (0)

There are no reviews for GFER/ALR Protein (NBP1-90187PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for GFER/ALR Protein (NBP1-90187PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GFER/ALR Products

Research Areas for GFER/ALR Protein (NBP1-90187PEP)

Find related products by research area.

Blogs on GFER/ALR

There are no specific blogs for GFER/ALR, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our GFER/ALR Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol GFER