GDPD5 Antibody

Images

 
Immunohistochemistry: GDPD5 Antibody [NBP2-49492] - Staining of human colon shows distinct membranous and cytoplasmic positivity in glandular cells while weak cytoplasmic staining in peripheral nerve/ganglion.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GDPD5 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LQKWRLGGIRSYNPEQIMLSAAVRRTSRDVSIMKEKLIFSEISDGVEVSDVLSVCSDNSYDTYANSTAT
Specificity
Specificity of human GDPD5 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GDPD5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GDPD5 Antibody

  • EC 3.1
  • GDE2
  • GDE2PP1665Glycerophosphodiester phosphodiesterase 2
  • GDPD5
  • glycerophosphodiester phosphodiesterase domain containing 5
  • glycerophosphodiester phosphodiesterase domain-containing protein 5
  • PP1665

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85630
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-34078
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAB7026
Species: Hu, Mu
Applications: ICC
NBP1-87730
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
NB300-560
Species: Hu, Mu, Rt, Av, Bv, Pm
Applications: WB, IHC, IHC-Fr, IHC-P, IF
NBP1-82558
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010908-M08
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-38492
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-69654
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP, Rb, Ze
Applications: WB, IHC, IHC-P
NBP2-01584
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-49492
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for GDPD5 Antibody (NBP2-49492) (0)

There are no publications for GDPD5 Antibody (NBP2-49492).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDPD5 Antibody (NBP2-49492) (0)

There are no reviews for GDPD5 Antibody (NBP2-49492). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GDPD5 Antibody (NBP2-49492) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional GDPD5 Products

Array NBP2-49492

Bioinformatics Tool for GDPD5 Antibody (NBP2-49492)

Discover related pathways, diseases and genes to GDPD5 Antibody (NBP2-49492). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDPD5 Antibody (NBP2-49492)

Discover more about diseases related to GDPD5 Antibody (NBP2-49492).
 

Pathways for GDPD5 Antibody (NBP2-49492)

View related products by pathway.

Research Areas for GDPD5 Antibody (NBP2-49492)

Find related products by research area.

Blogs on GDPD5

There are no specific blogs for GDPD5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDPD5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDPD5