Recombinant Human GDNF Protein

Images

 

Product Details

Summary
Product Discontinued
View other related GDNF Peptides and Proteins

Order Details


    • Catalog Number
      P4394
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human GDNF Protein Summary

Description
GDNF (Human) Recombinant Protein

Source: E. coli

Amino Acid Sequence: MSPDKQMAVLPRRERNRQAAAANPENSRGKGRRGQRGKNRGCVLTAIHLNVTDLGLGYETKEELIFRYCSGSCDAAETTYDKILKNLSRNRRLVSDKVGQACCRPIAFDDDLSFLDDNLVYHILRKHSAKRCGCI
Preparation
Method
Escherichia coli expression system
Details of Functionality
The activity is determined by the dose-dependent proliferation of C6 cells. The expected ED50 for this effect is 1.7-2.6 ug/mL.
Protein/Peptide Type
Recombinant Protein
Gene
GDNF

Applications/Dilutions

Application Notes
This product is useful for Func,SDS-PAGE.
Publications
Read Publication using P4394.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
Lyophilized from 10 mM sodium citrate, 100 mM NaCl, pH 4.0
Preservative
No Preservative
Reconstitution Instructions
Reconstitute with sterilized water to desired concentration.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GDNF Protein

  • Astrocyte-derived trophic factor
  • ATF
  • ATF1
  • ATF2
  • GDNF
  • glial cell derived neurotrophic factor
  • glial cell line derived neurotrophic factor
  • glial cell line-derived neurotrophic factor
  • HFB1-GDNF
  • hGDNF
  • HSCR3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF482
Species: Mu
Applications: WB, IHC
AF1085
Species: Mu
Applications: WB, IHC, Neut
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
AF477
Species: Hu, Mu
Applications: WB, IHC, Block
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
557-NT/CF
Species: Rt
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB
P4394
Species: Hu
Applications: Func, PAGE

Publications for GDNF Recombinant Protein (P4394)(1)

Reviews for GDNF Recombinant Protein (P4394) (0)

There are no reviews for GDNF Recombinant Protein (P4394). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for GDNF Recombinant Protein (P4394) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GDNF Products

Bioinformatics Tool for GDNF Recombinant Protein (P4394)

Discover related pathways, diseases and genes to GDNF Recombinant Protein (P4394). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDNF Recombinant Protein (P4394)

Discover more about diseases related to GDNF Recombinant Protein (P4394).
 

Pathways for GDNF Recombinant Protein (P4394)

View related products by pathway.

PTMs for GDNF Recombinant Protein (P4394)

Learn more about PTMs related to GDNF Recombinant Protein (P4394).
 

Research Areas for GDNF Recombinant Protein (P4394)

Find related products by research area.

Blogs on GDNF.

The identification of dopaminergic neurons using Tyrosine Hydroxylase in Parkinson's research and LRRK2
Tyrosine hydroxylase (TH) is a crucial enzyme involved in the biosynthesis of dopamine, norepinephrine and epinephrine in the brain.  Specifically, TH catalyzes the conversion of l-tyrosine to l-dihydroxyphenylalanine (l-dopa).  The importance of t...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GDNF Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GDNF
Entrez