GDF-9 Antibody ([53/1]) [DyLight 594]

Images

 
There are currently no images for GDF-9 Antibody (NBP2-61934DL594).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
Clone
[53/1]
Clonality
Monoclonal
Host
Mouse
Conjugate
DyLight 594

GDF-9 Antibody ([53/1]) [DyLight 594] Summary

Immunogen
Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9
Isotype
IgG1
Clonality
Monoclonal
Host
Mouse
Gene
GDF9
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunohistochemistry
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
Protein A purified

Alternate Names for GDF-9 Antibody ([53/1]) [DyLight 594]

  • GDF9
  • GDF-9
  • growth differentiation factor 9
  • growth/differentiation factor 9

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

5096-BM
Species: Hu
NBP1-84310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF3797
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
NBP2-36489
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
NBP2-38770
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-77836
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
355-BM/CF
Species: Hu, Mu, Rt
NBP2-61934DL594
Species: Hu
Applications: WB, ELISA, IHC

Publications for GDF-9 Antibody (NBP2-61934DL594) (0)

There are no publications for GDF-9 Antibody (NBP2-61934DL594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-9 Antibody (NBP2-61934DL594) (0)

There are no reviews for GDF-9 Antibody (NBP2-61934DL594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDF-9 Antibody (NBP2-61934DL594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GDF-9 Antibody (NBP2-61934DL594)

Discover related pathways, diseases and genes to GDF-9 Antibody (NBP2-61934DL594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDF-9 Antibody (NBP2-61934DL594)

Discover more about diseases related to GDF-9 Antibody (NBP2-61934DL594).
 

Pathways for GDF-9 Antibody (NBP2-61934DL594)

View related products by pathway.

PTMs for GDF-9 Antibody (NBP2-61934DL594)

Learn more about PTMs related to GDF-9 Antibody (NBP2-61934DL594).
 

Research Areas for GDF-9 Antibody (NBP2-61934DL594)

Find related products by research area.

Blogs on GDF-9

There are no specific blogs for GDF-9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GDF-9 [Unconjugated]
739-G9-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDF-9 Antibody ([53/1]) [DyLight 594] and receive a gift card or discount.

Bioinformatics

Gene Symbol GDF9
Entrez