GDF-9 Antibody (53/1) [DyLight 594]


There are currently no images for GDF-9 Antibody (NBP2-61934DL594).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ELISA, IHC
DyLight 594

GDF-9 Antibody (53/1) [DyLight 594] Summary

Tuberculin coupled peptide with sequence VPAKYSPLSVLTIEPDGSIAYKEYEDMIATKC that recognizes an epitope with the EPDG sequence near the C-terminal region of human GDF9
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot
  • Immunohistochemistry
Application Notes
Optimal dilution of this antibody should be experimentally determined.

Packaging, Storage & Formulations

Store at 4C in the dark.
0.05% Sodium Azide
Protein A purified

Alternate Names for GDF-9 Antibody (53/1) [DyLight 594]

  • GDF9
  • GDF-9
  • growth differentiation factor 9
  • growth/differentiation factor 9


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Simple Western, ChIP, ICC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Species: Hu
Applications: Flow, IHC, CyTOF-ready
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Ch, Xp, Ze
Applications: WB, ELISA, Flow, IHC, IHC-P, Single Cell Western
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
Species: Hu, Mu, Rt
Species: Hu
Applications: WB, ELISA, IHC

Publications for GDF-9 Antibody (NBP2-61934DL594) (0)

There are no publications for GDF-9 Antibody (NBP2-61934DL594).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-9 Antibody (NBP2-61934DL594) (0)

There are no reviews for GDF-9 Antibody (NBP2-61934DL594). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDF-9 Antibody (NBP2-61934DL594) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional Array Products

Bioinformatics Tool for GDF-9 Antibody (NBP2-61934DL594)

Discover related pathways, diseases and genes to GDF-9 Antibody (NBP2-61934DL594). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDF-9 Antibody (NBP2-61934DL594)

Discover more about diseases related to GDF-9 Antibody (NBP2-61934DL594).

Pathways for GDF-9 Antibody (NBP2-61934DL594)

View related products by pathway.

PTMs for GDF-9 Antibody (NBP2-61934DL594)

Learn more about PTMs related to GDF-9 Antibody (NBP2-61934DL594).

Research Areas for GDF-9 Antibody (NBP2-61934DL594)

Find related products by research area.

Blogs on GDF-9

There are no specific blogs for GDF-9, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GDF-9 [Unconjugated]

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GDF-9 Antibody (53/1) [DyLight 594] and receive a gift card or discount.


Gene Symbol GDF9