Recombinant Human GDF-7/BMP-12 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related GDF-7/BMP-12 Peptides and Proteins

Order Details


    • Catalog Number
      H00151449-Q02
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human GDF-7/BMP-12 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 204 - 301 of Human GDF7 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VGQRWEAFDVADAMRRHRREPRPPRAFCLLLRAVAGPVPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESLFREIRAQARALGAALASEPLP

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GDF7

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GDF-7/BMP-12 Protein

  • BMP12
  • BMP-12
  • GDF7
  • GDF-7
  • growth differentiation factor 7
  • growth/differentiation factor 7

Background

This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF855
Species: Mu
Applications: IHC
AF853
Species: Mu
Applications: WB, IHC
355-BM/CF
Species: Hu, Mu, Rt
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP2-14889
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
MAB1419
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
AF2667
Species: Hu
Applications: WB, IHC
NB100-74350
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF346
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-31318
Species: Mu
Applications: IHC-P
NBP2-37619
Species: Hu
Applications: WB, ELISA, ICC/IF
AF811
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready

Publications for GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02) (0)

There are no publications for GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02) (0)

There are no reviews for GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GDF-7/BMP-12 Products

Bioinformatics Tool for GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02)

Discover related pathways, diseases and genes to GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02)

Discover more about diseases related to GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02).
 

Pathways for GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02)

View related products by pathway.

PTMs for GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02)

Learn more about PTMs related to GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02).
 

Research Areas for GDF-7/BMP-12 Partial Recombinant Protein (H00151449-Q02)

Find related products by research area.

Blogs on GDF-7/BMP-12

There are no specific blogs for GDF-7/BMP-12, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GDF-7/BMP-12 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GDF7
Entrez