GDF-7/BMP-12 Antibody (2A2)



Product Details

Product Discontinued
View other related GDF-7/BMP-12 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GDF-7/BMP-12 Antibody (2A2) Summary

GDF7 (NP_878248, 204 a.a. ~ 301 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.vgqrweafdvadamrrhrreprpprafclllravagp vpsplalrrlgfgwpggggsaaeeravlvvssrtqrkesl freiraqaralgaalaseplp
IgG2a Kappa
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


Application Notes
This antibody is useful for ELISA

Reactivity Notes

This product is reactive against Human.

Packaging, Storage & Formulations

Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
PBS (pH 7.4)
No Preservative
IgG purified


This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GDF-7/BMP-12 Antibody (2A2)

  • BMP12
  • BMP-12
  • GDF7
  • GDF-7
  • growth differentiation factor 7
  • growth/differentiation factor 7


This gene encodes a member of the bone morphogenetic protein (BMP) family. BMPs belong to the transforming growth factor-beta superfamily of secreted signalling molecules that regulate diverse processes in growth, repair and embryonic development. In mouse, this gene functions as an inductive signal from the roof plate required for the specification of neuronal identity in the dorsal spinal cord.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: IHC
Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-Fr, IHC-P
Species: Hu, Rt
Applications: IHC, CyTOF-ready, ICC, ICFlow
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Po, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, Flow, CyTOF-ready
Species: Mu
Applications: IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready

Publications for GDF-7/BMP-12 Antibody (H00151449-M11) (0)

There are no publications for GDF-7/BMP-12 Antibody (H00151449-M11).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-7/BMP-12 Antibody (H00151449-M11) (0)

There are no reviews for GDF-7/BMP-12 Antibody (H00151449-M11). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GDF-7/BMP-12 Antibody (H00151449-M11) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GDF-7/BMP-12 Products

Bioinformatics Tool for GDF-7/BMP-12 Antibody (H00151449-M11)

Discover related pathways, diseases and genes to GDF-7/BMP-12 Antibody (H00151449-M11). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDF-7/BMP-12 Antibody (H00151449-M11)

Discover more about diseases related to GDF-7/BMP-12 Antibody (H00151449-M11).

Pathways for GDF-7/BMP-12 Antibody (H00151449-M11)

View related products by pathway.

PTMs for GDF-7/BMP-12 Antibody (H00151449-M11)

Learn more about PTMs related to GDF-7/BMP-12 Antibody (H00151449-M11).

Research Areas for GDF-7/BMP-12 Antibody (H00151449-M11)

Find related products by research area.

Blogs on GDF-7/BMP-12

There are no specific blogs for GDF-7/BMP-12, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GDF-7/BMP-12 Antibody (2A2) and receive a gift card or discount.


Gene Symbol GDF7