GDF-15 Antibody

Images

 
Western Blot: GDF-15 Antibody [NBP1-59325] - PANC1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related GDF-15 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-59325
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GDF-15 Antibody Summary

Immunogen
Synthetic peptides corresponding to GDF15(growth differentiation factor 15) The peptide sequence was selected from the N terminal of GDF15. Peptide sequence ASRASFPGPSELHSEDSRFRELRKRYEDLLTRLRANQSWEDSNTDLVPAP.
Clonality
Polyclonal
Host
Rabbit
Gene
GDF15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GDF15 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS & 2% Sucrose.
Preservative
No Preservative
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GDF-15 Antibody

  • GDF15
  • GDF-15
  • growth differentiation factor 15
  • growth/differentiation factor 15
  • Macrophage inhibitory cytokine 1
  • MIC-1
  • MIC-1NSAID-activated gene 1 protein
  • MIC1Prostate differentiation factor
  • NAG-1
  • NAG-1NSAID-regulated gene 1 protein
  • NSAID (nonsteroidal inflammatory drug)-activated protein 1
  • PDF
  • PDFGDF-15
  • PLAB
  • PLABNRG-1
  • Placental bone morphogenetic protein
  • Placental TGF-beta
  • PTGF-beta
  • PTGFBPTGF-beta

Background

Bone morphogenetic proteins (e.g., BMP9; MIM 605120) are members of the transforming growth factor-beta (see TGFB1; MIM 190180) superfamily and regulate tissue differentiation and maintenance. They are synthesized as precursor molecules that are processed

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
H00001958-M03
Species: Hu, Rb
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB120-3104
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IP
NBP2-22106
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP1-85816
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready

Publications for GDF-15 Antibody (NBP1-59325) (0)

There are no publications for GDF-15 Antibody (NBP1-59325).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDF-15 Antibody (NBP1-59325) (0)

There are no reviews for GDF-15 Antibody (NBP1-59325). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDF-15 Antibody (NBP1-59325) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GDF-15 Products

Bioinformatics Tool for GDF-15 Antibody (NBP1-59325)

Discover related pathways, diseases and genes to GDF-15 Antibody (NBP1-59325). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDF-15 Antibody (NBP1-59325)

Discover more about diseases related to GDF-15 Antibody (NBP1-59325).
 

Pathways for GDF-15 Antibody (NBP1-59325)

View related products by pathway.

PTMs for GDF-15 Antibody (NBP1-59325)

Learn more about PTMs related to GDF-15 Antibody (NBP1-59325).
 

Research Areas for GDF-15 Antibody (NBP1-59325)

Find related products by research area.

Blogs on GDF-15

There are no specific blogs for GDF-15, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GDF-15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GDF15
Entrez
Uniprot