Recombinant Human GDAP1 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GDAP1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 158-257 of Human GDAP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TRIRSQIGNTESELKKLAEENPDLQEAYIAKQKRLKSKLLDHDNVKYLKKILDELEKVLDQVETELQRRNEETPEEGQQPWLCGESFTLADVSLAVTLHR

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
GDAP1
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GDAP1 Protein

  • Charcot-Marie-Tooth neuropathy 4A
  • CMT2K
  • CMT4
  • CMT4A
  • CMTRIA
  • ganglioside differentiation associated protein 1
  • ganglioside-induced differentiation-associated protein 1
  • truncated ganglioside differentiation associated protein 1

Background

GDAP1 - ganglioside-induced differentiation-associated protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-1607
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP2-13283
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33580
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB100-57493
Species: Hu, Mu
Applications: WB, IP
H00009927-M03
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-55414
Species: Hu
Applications: WB, ICC/IF
NBP2-53384
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
NBP2-25151
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NB110-59723
Species: Hu, Mu, Po
Applications: WB, ICC/IF, IF
NBL1-15012
Species: Hu
NBP2-19779
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NBP1-86636
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB300-131
Species: Hu, Mu, Rt, Po, Av, Bv, Ma
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89598
Species: Hu, Mu, Ca
Applications: IHC, IHC-Fr, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-38360
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-47477
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-33633
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-89146
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for GDAP1 Partial Recombinant Protein (H00054332-Q01) (0)

There are no publications for GDAP1 Partial Recombinant Protein (H00054332-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GDAP1 Partial Recombinant Protein (H00054332-Q01) (0)

There are no reviews for GDAP1 Partial Recombinant Protein (H00054332-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GDAP1 Partial Recombinant Protein (H00054332-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GDAP1 Products

Bioinformatics Tool for GDAP1 Partial Recombinant Protein (H00054332-Q01)

Discover related pathways, diseases and genes to GDAP1 Partial Recombinant Protein (H00054332-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GDAP1 Partial Recombinant Protein (H00054332-Q01)

Discover more about diseases related to GDAP1 Partial Recombinant Protein (H00054332-Q01).
 

Pathways for GDAP1 Partial Recombinant Protein (H00054332-Q01)

View related products by pathway.

PTMs for GDAP1 Partial Recombinant Protein (H00054332-Q01)

Learn more about PTMs related to GDAP1 Partial Recombinant Protein (H00054332-Q01).

Blogs on GDAP1

There are no specific blogs for GDAP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

NF-L Antibody
NB300-131
GDAP1 Antibody
NBP1-84430

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GDAP1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GDAP1