GCNT3 Antibody

Images

 
Western Blot: GCNT3 Antibody [NBP1-69656] - This Anti-GCNT3 antibody was used in Western Blot of Transfected 293T tissue lysate at a concentration of 1.25ug/ml.
Immunohistochemistry: GCNT3 Antibody [NBP1-69656] - Human kidney.

Product Details

Summary
Product Discontinued
View other related GCNT3 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69656
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GCNT3 Antibody Summary

Immunogen
Synthetic peptides corresponding to GCNT3(glucosaminyl (N-acetyl) transferase 3, mucin type) The peptide sequence was selected from the C terminal of GCNT3. Peptide sequence AICVYGAGDLNWMLQNHHLLANKFDPKVDDNALQCLEEYLRYKAIYGTEL.
Clonality
Polyclonal
Host
Rabbit
Gene
GCNT3
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
51 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GCNT3 Antibody

  • beta-1,3-galactosyl-O-glycosyl-glycoproteinbeta-1,6-N-acetylglucosaminyltransferase 3
  • beta1,6GlcNAc-transferase
  • beta1,6-N-acetylglucosaminyltransferase-M
  • C2/4GnTGNTM
  • C24GNT
  • C2GnT2
  • C2GNTM
  • C2GnT-M
  • C2GnT-mucin type
  • Core 2/core 4 beta-1,6-N-acetylglucosaminyltransferase
  • EC 2.4.1.102
  • EC 2.4.1.150
  • glucosaminyl (N-acetyl) transferase 3, mucin type
  • hC2GnT-M
  • mucus-type core 2 beta-1,6-N-acetylglucosaminyltransferase

Background

This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.This enzyme catalyzes O-glycan branch synthesis of the core 2 and core 4 type in mucins and controls expression of core 2 branched oligosaccharides and I antigens on the cell surface.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF7248
Species: Hu
Applications: WB, ICC
NBP2-55686
Species: Hu
Applications: ICC/IF
NBP1-88270
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88952
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NB120-11197
Species: Hu, Mu
Applications: WB, Flow, IHC, IHC-Fr, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-88781
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71701
Species: Hu, Mu
Applications: WB
AF5128
Species: Hu, Mu, Rt
Applications: WB
NBP2-52532
Species: Hu, Rt, Mk
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
MAB2038
Species: Hu
Applications: Flow, CyTOF-ready, ICC
NBP2-56499
Species: Hu
Applications: ICC/IF
NBP1-69656
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GCNT3 Antibody (NBP1-69656) (0)

There are no publications for GCNT3 Antibody (NBP1-69656).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCNT3 Antibody (NBP1-69656) (0)

There are no reviews for GCNT3 Antibody (NBP1-69656). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GCNT3 Antibody (NBP1-69656) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCNT3 Products

Bioinformatics Tool for GCNT3 Antibody (NBP1-69656)

Discover related pathways, diseases and genes to GCNT3 Antibody (NBP1-69656). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCNT3 Antibody (NBP1-69656)

Discover more about diseases related to GCNT3 Antibody (NBP1-69656).
 

Pathways for GCNT3 Antibody (NBP1-69656)

View related products by pathway.

PTMs for GCNT3 Antibody (NBP1-69656)

Learn more about PTMs related to GCNT3 Antibody (NBP1-69656).
 

Research Areas for GCNT3 Antibody (NBP1-69656)

Find related products by research area.

Blogs on GCNT3

There are no specific blogs for GCNT3, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCNT3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GCNT3
Uniprot