GCLC Antibody (3H1) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related GCLC Primary Antibodies

Order Details


    • Catalog Number
      H00002729-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GCLC Antibody (3H1) [PE] Summary

Immunogen
GCLC (NP_001489 528 a.a. - 637 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EGVFPGLIPILNSYLENMEVDVDTRCSILNYLKLIKKRASGELMTVARWMREFIANHPDYKQDSVITDEMNYSLILKCNQIANELCECPELLGSAFRKVKYSGSKTDSSN
Specificity
GCLC - glutamate-cysteine ligase, catalytic subunit
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GCLC
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GCLC Antibody (3H1) [PE]

  • EC 6.3.2.2
  • gamma-ECS
  • Gamma-glutamylcysteine synthetase
  • GCS heavy chain
  • GCS
  • GLCL
  • GLCLCGCL
  • glutamate--cysteine ligase catalytic subunit
  • glutamate-cysteine ligase, catalytic subunit

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-32822
Species: Hu, Mu, Rt
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-16684
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-03351
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-33405
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
H00002551-M03
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-50037
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF
H00002678-M01
Species: Hu, Mu
Applications: WB, ELISA, IHC-P, IP
NBP1-97507
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NB300-731
Species: Hu, Mu, Rt, GP, Rb, Sh, Ye
Applications: WB, ChIP, B/N, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB100-56530
Species: Hu
Applications: WB
MAB5526
Species: Hu, Mu
Applications: WB

Publications for GCLC Antibody (H00002729-M01PE) (0)

There are no publications for GCLC Antibody (H00002729-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCLC Antibody (H00002729-M01PE) (0)

There are no reviews for GCLC Antibody (H00002729-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GCLC Antibody (H00002729-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCLC Products

Bioinformatics Tool for GCLC Antibody (H00002729-M01PE)

Discover related pathways, diseases and genes to GCLC Antibody (H00002729-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCLC Antibody (H00002729-M01PE)

Discover more about diseases related to GCLC Antibody (H00002729-M01PE).
 

Pathways for GCLC Antibody (H00002729-M01PE)

View related products by pathway.

PTMs for GCLC Antibody (H00002729-M01PE)

Learn more about PTMs related to GCLC Antibody (H00002729-M01PE).
 

Research Areas for GCLC Antibody (H00002729-M01PE)

Find related products by research area.

Blogs on GCLC.

The effects of ethanol consumption on glutamate production and xCT
xCT is a sodium independent glutamate transporter that regulates the exchange of extracellular l-cystine and intracellular l-glutamate across the plasma membrane. This process is critical to glutathione production and protection from subsequent ox...  Read full blog post.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCLC Antibody (3H1) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol GCLC