GCDH Antibody


Western Blot: GCDH Antibody [NBP1-74195] - Rat Brain Lysate 1ug/ml Gel Concentration 12%

Product Details

Product Discontinued
View other related GCDH Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GCDH Antibody Summary

Synthetic peptides corresponding to the C terminal of Gcdh. Immunizing peptide sequence LQLGRLKDQDKATPEMVSLLKRNNCGKALDIARQARDILGGNGISDEYHV.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Gcdh and was validated on Western blot.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS & 2% Sucrose.
No Preservative
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GCDH Antibody

  • ACAD5
  • EC 1.3.99
  • EC
  • GCD
  • glutaryl-CoA dehydrogenase
  • glutaryl-CoA dehydrogenase, mitochondrial
  • glutaryl-Coenzyme A dehydrogenase


The function of this protein remains unknown.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mk, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
Species: Hu
Applications: WB, IHC
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Ye
Applications: WB

Publications for GCDH Antibody (NBP1-74195) (0)

There are no publications for GCDH Antibody (NBP1-74195).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCDH Antibody (NBP1-74195) (0)

There are no reviews for GCDH Antibody (NBP1-74195). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GCDH Antibody (NBP1-74195) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional GCDH Products

Bioinformatics Tool for GCDH Antibody (NBP1-74195)

Discover related pathways, diseases and genes to GCDH Antibody (NBP1-74195). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCDH Antibody (NBP1-74195)

Discover more about diseases related to GCDH Antibody (NBP1-74195).

Pathways for GCDH Antibody (NBP1-74195)

View related products by pathway.

PTMs for GCDH Antibody (NBP1-74195)

Learn more about PTMs related to GCDH Antibody (NBP1-74195).

Blogs on GCDH

There are no specific blogs for GCDH, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our GCDH Antibody and receive a gift card or discount.


Gene Symbol GCDH