GCAP2 Antibody

Images

 
Immunohistochemistry-Paraffin: GCAP2 Antibody [NBP1-89789] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts and Leydig cells.

Product Details

Summary
Product Discontinued
View other related GCAP2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-89789
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GCAP2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:QLKKACRRELQTEQGQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GUCA1B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (83%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GCAP2 Antibody

  • DKFZp686E1183
  • GCAP 2
  • GCAP2guanylate cyclase-activating protein, photoreceptor 2
  • guanylate cyclase activator 1B (retina)
  • Guanylate cyclase activator 1B
  • guanylyl cyclase-activating protein 2
  • GUCA2
  • RP48

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00002978-R01V
Species: Hu
H00003000-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
H00000251-M07
Species: Hu
Applications: WB, ELISA, IHC-P, IP, RNAi
NBP2-08197
Species: Hu
H00009626-D01P
Species: Hu
Applications: WB, ELISA, ICC/IF
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-84880
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24535
Species: Hu, Mu, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00002981-T01
Species: Hu
NBP1-47602
Species: Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBL1-16053
Species: Hu
NBP1-81788
Species: Hu
Applications: IHC, IHC-P
NBP1-89724
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP1-89789
Species: Hu
Applications: IHC, IHC-P

Publications for GCAP2 Antibody (NBP1-89789) (0)

There are no publications for GCAP2 Antibody (NBP1-89789).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GCAP2 Antibody (NBP1-89789) (0)

There are no reviews for GCAP2 Antibody (NBP1-89789). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for GCAP2 Antibody (NBP1-89789) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GCAP2 Products

Bioinformatics Tool for GCAP2 Antibody (NBP1-89789)

Discover related pathways, diseases and genes to GCAP2 Antibody (NBP1-89789). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GCAP2 Antibody (NBP1-89789)

Discover more about diseases related to GCAP2 Antibody (NBP1-89789).
 

Pathways for GCAP2 Antibody (NBP1-89789)

View related products by pathway.

PTMs for GCAP2 Antibody (NBP1-89789)

Learn more about PTMs related to GCAP2 Antibody (NBP1-89789).
 

Research Areas for GCAP2 Antibody (NBP1-89789)

Find related products by research area.

Blogs on GCAP2

There are no specific blogs for GCAP2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GCAP2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GUCA1B