GBAS Antibody

Images

 
Western Blot: GBAS Antibody [NBP1-52852] - THP-1 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related GBAS Primary Antibodies

Order Details


    • Catalog Number
      NBP1-52852
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GBAS Antibody Summary

Immunogen
Synthetic peptides corresponding to GBAS(glioblastoma amplified sequence) The peptide sequence was selected from the middle region of GBAS. Peptide sequence VPRSGPNIYELRSYQLRPGTMIEWGNYWARAIRFRQDGNEAVGGFFSQIG.
Clonality
Polyclonal
Host
Rabbit
Gene
GBAS
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GBAS and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GBAS Antibody

  • glioblastoma amplified sequence
  • Glioblastoma-amplified sequence
  • NIPSNAP2NipSnap2,4-nitrophenylphosphatase domain and non-neuronal SNAP25-like 2
  • protein NipSnap homolog 2

Background

Chromosomal region 7p12, which contains GBAS, is amplified in approximately 40% of glioblastomas, the most common and malignant form of central nervous system tumor.The predicted 286-amino acid protein contains a signal peptide, a transmembrane domain, and 2 tyrosine phosphorylation sites. The GBAS transcript is expressed most abundantly in heart and skeletal muscle. GBAS protein might be involved in vesicular transport.Chromosomal region 7p12, which contains GBAS, is amplified in approximately 40% of glioblastomas, the most common and malignant form of central nervous system tumor.The predicted 286-amino acid protein contains a signal peptide, a transmembrane domain, and 2 tyrosine phosphorylation sites. The GBAS transcript is expressed most abundantly in heart and skeletal muscle. GBAS protein might be involved in vesicular transport.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76888
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-91169
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002629-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP2-00795
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP1-19160
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP
NBP2-35006
Species: Hu
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, Func, IA, IHC, IHC-Fr, IHC-P, IP
NBP2-54746
Species: Hu
Applications: ICC/IF, IHC-P
NB100-410
Species: Hu, Mu
Applications: WB, IP
NBP1-88532
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-74138
Species: Hu, Rt
Applications: WB, ICC/IF, IHC
NBP1-52852
Species: Hu
Applications: WB

Publications for GBAS Antibody (NBP1-52852) (0)

There are no publications for GBAS Antibody (NBP1-52852).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GBAS Antibody (NBP1-52852) (0)

There are no reviews for GBAS Antibody (NBP1-52852). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GBAS Antibody (NBP1-52852) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GBAS Products

Bioinformatics Tool for GBAS Antibody (NBP1-52852)

Discover related pathways, diseases and genes to GBAS Antibody (NBP1-52852). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GBAS Antibody (NBP1-52852)

Discover more about diseases related to GBAS Antibody (NBP1-52852).
 

Pathways for GBAS Antibody (NBP1-52852)

View related products by pathway.

PTMs for GBAS Antibody (NBP1-52852)

Learn more about PTMs related to GBAS Antibody (NBP1-52852).

Blogs on GBAS

There are no specific blogs for GBAS, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GBAS Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GBAS
Uniprot