Recombinant Human GATE-16/GABARAPL2 Protein

Product Discontinued

Recombinant Human GATE-16/GABARAPL2 Protein Summary

• Description: A full-length recombinant protein with His tag corresponding to the amino acids 1 - 117 of Human GABARAPL2
  
  

  Source: Escherichia coli

  Amino Acid Sequence:MGSSHHHHHHSSGLVPRGSHMKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSSLTMGQLYEKEKDEDGFLYVAYSGENTFGF

• Preparation Method: Escherichia coli expression system
• Protein/Peptide Type: Recombinant Protein
• Gene: GABARAPL2

Applications/Dilutions

• Dilutions:
  • SDS-Page
• Application Notes: This product is useful for SDS-PAGE.

Reactivity Notes

Human

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: In 20 mM Tris-HCl, 0.2 M NaCl, pH 8.0 (5 mM dithiothreitol, 20% glycerol)
• Preservative: No Preservative

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GATE-16/GABARAPL2 Protein

• Apg8p2
• ATG8
• ATG8C
• FLC3A
• GABARAPL2
• gamma-aminobutyric acid receptor-associated protein-like 2
• Ganglioside expression factor 2
• GATE16
• GATE-16
• GEF2
• GEF-2
• GEF2GEF-2
• General Protein Transport Factor P16
• Golgi-Associated ATPase Enhancer Of 16 KDa
• MAP1 light chain 3 related protein
• MAP1 light chain 3-related protein

Background

GABARAPL2, also known as GATE-16, is involved in intra-Golgi traffic and belongs to the MAP1 LC3 family. GABARAPL2 modulates intra-Golgi transport through coupling between NSF activity and SNAREs activation. GABARAPL2 first stimulates the ATPase activity of NSF which in turn stimulates the association with GOSR1. GABARAPL2 interacts with GABRG2, NSF, GOSR1 and beta-tubulin. The subcellular location of GABARAPL2 is the Golgi apparatus. GABARAPL2 is expressed at high levels in the brain, heart, prostate, ovary, spleen and skeletal muscle, and is expressed at very low levels in lung, thymus and small intestine.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

FAQs for GATE-16/GABARAPL2 Recombinant Protein (P3565). (Showing 1 - 1 of 1 FAQ).

1. I am currently interested in detecting GABARAPL2 by immunofluorescence. Do you have an antibody that I could try out for immunofluorescence
   • Here is the link using our search bar and filters

Bioinformatics

• Gene Symbol: GABARAPL2