Recombinant Human Gastrokine 1 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Gastrokine 1 Peptides and Proteins

Order Details


    • Catalog Number
      H00056287-P01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Gastrokine 1 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 21-185 of Human GKN1 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:NYNINVNDDNNNAGSGQQSVSVNNEHNVANVDNNNGWDSWNSIWDYGNGFAATRLFQKKTCIVHKMNKEVMPSIQSLDALVKEKKLQGKGPGGPPPKGLMYSVNPNKVDDLSKFGKNIANMCRGIPTYMAEEMQEASLFFYSGTCYTTSVLWIVDISFCGDTVEN

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Recombinant Protein
Gene
GKN1

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.
Publications
Read Publication using H00056287-P01.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 150 mM NaCl, pH 7.5, 0.25 mM DTT, 0.1 mM EGTA, 0.1 mM EDTA, 0.1 mM PMSF, 25% glycerol

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Gastrokine 1 Protein

  • 18 kDa antrum mucosa protein
  • AMP18
  • AMP-18
  • AMP18BRICHOS domain containing 1
  • BRICD1
  • CA11
  • CA11MGC70354
  • FOV
  • Foveolin
  • Gastrokine 1
  • gastrokine-1
  • GKN1
  • Protein CA11

Background

GKN1( AAH59778, 21 a.a. - 186 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-07100
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-20619
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-585
Species: Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
NBP1-86919
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31688
Species: Hu
Applications: IHC, IHC-P
NBP1-80775
Species: Hu
Applications: IHC, IHC-P
NBP2-32001
Species: Hu, Mu
Applications: IHC, IHC-P
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-31586
Species: Hu
Applications: IHC, IHC-P
NBP1-86654
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84597
Species: Hu
Applications: WB, IHC, IHC-P
MAB9167
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready, ICC
NBP2-56762
Species: Hu
Applications: WB, ICC/IF
NBP2-15196
Species: Hu, Mu, Rt, Po, Ch, Fe, Pm, Rb, Bv(-)
Applications: Flow, ICC/IF, IHC-Fr, IHC-P, Flow-IC
NB100-2564
Species: Hu
Applications: WB
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00056287-P01
Species: Hu
Applications: WB, ELISA, PA

Publications for Gastrokine 1 Recombinant Protein (H00056287-P01)(1)

We have publications tested in 1 confirmed species: Human.


Filter By Application
All Applications
Filter By Species
Human
(1)
All Species

Reviews for Gastrokine 1 Recombinant Protein (H00056287-P01) (0)

There are no reviews for Gastrokine 1 Recombinant Protein (H00056287-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gastrokine 1 Recombinant Protein (H00056287-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gastrokine 1 Products

Bioinformatics Tool for Gastrokine 1 Recombinant Protein (H00056287-P01)

Discover related pathways, diseases and genes to Gastrokine 1 Recombinant Protein (H00056287-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gastrokine 1 Recombinant Protein (H00056287-P01)

Discover more about diseases related to Gastrokine 1 Recombinant Protein (H00056287-P01).
 

Pathways for Gastrokine 1 Recombinant Protein (H00056287-P01)

View related products by pathway.

PTMs for Gastrokine 1 Recombinant Protein (H00056287-P01)

Learn more about PTMs related to Gastrokine 1 Recombinant Protein (H00056287-P01).
 

Research Areas for Gastrokine 1 Recombinant Protein (H00056287-P01)

Find related products by research area.

Blogs on Gastrokine 1

There are no specific blogs for Gastrokine 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Gastrokine 1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GKN1
Entrez