Gastric Lipase Antibody (3B3)

Images

 
Sandwich ELISA: Gastric Lipase Antibody (3B3) [H00008513-M02] - Detection limit for recombinant GST tagged LIPF is approximately 0.1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
3B3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Gastric Lipase Antibody (3B3) Summary

Immunogen
LIPF (NP_004181, 299 a.a. - 398 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KSGKFQAYDWGSPVQNRMHYDQSQPPYYNVTAMNVPIAVWNGGKDLLADPQDVGLLLPKLPNLIYHKEIPFYNHLDFIWAMDAPQEVYNDIVSMISEDKK
Specificity
LIPF - lipase, gastric (3B3)
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
LIPF
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Gastric Lipase Antibody (3B3)

  • EC 3.1.1
  • EC 3.1.1.3
  • Gastric lipase
  • gastric triacylglycerol lipase
  • GL
  • HGL
  • HLAL
  • lipase, gastric
  • MGC138477
  • MGC142271

Background

This gene encodes gastric lipase, an enzyme involved in the digestion of dietary triglycerides in the gastrointestinal tract, and responsible for 30% of fat digestion processes occurring in human. It is secreted by gastric chief cells in the fundic mucosa of the stomach, and it hydrolyzes the ester bonds of triglycerides under acidic pH conditions. The gene is a member of a conserved gene family of lipases that play distinct roles in neutral lipid metabolism.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-52926
Species: Hu
Applications: WB
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32789
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76544
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P
NBP1-88866
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-54155
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-59934
Species: Hu
Applications: WB
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-46376
Species: Hu
Applications: WB, IHC
NBP2-20383
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF6144
Species: Hu
Applications: WB, Simple Western
NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Gastric Lipase Antibody (H00008513-M02) (0)

There are no publications for Gastric Lipase Antibody (H00008513-M02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gastric Lipase Antibody (H00008513-M02) (0)

There are no reviews for Gastric Lipase Antibody (H00008513-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gastric Lipase Antibody (H00008513-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gastric Lipase Products

Bioinformatics Tool for Gastric Lipase Antibody (H00008513-M02)

Discover related pathways, diseases and genes to Gastric Lipase Antibody (H00008513-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gastric Lipase Antibody (H00008513-M02)

Discover more about diseases related to Gastric Lipase Antibody (H00008513-M02).
 

Pathways for Gastric Lipase Antibody (H00008513-M02)

View related products by pathway.

PTMs for Gastric Lipase Antibody (H00008513-M02)

Learn more about PTMs related to Gastric Lipase Antibody (H00008513-M02).
 

Research Areas for Gastric Lipase Antibody (H00008513-M02)

Find related products by research area.

Blogs on Gastric Lipase

There are no specific blogs for Gastric Lipase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gastric Lipase Antibody (3B3) and receive a gift card or discount.

Bioinformatics

Gene Symbol LIPF
Entrez
Uniprot