Recombinant Human Gas6 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related Gas6 Peptides and Proteins

Order Details


    • Catalog Number
      H00002621-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human Gas6 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-100 of Human GAS6 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:VSLRDGEATLEVDGTRGQSEVSAAQLQERLAVLERHLRSPVLTFAGGLPDVPVTSAPVTAFYRGCMTLEVNRRLLDLDEAAYKHSDITAHSCPPVEPAAA

Protein/Peptide Type
Partial Recombinant Protein
Gene
GAS6

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Gas6 Protein

  • AXLLG
  • AXLLGAXL stimulatory factor
  • AXSFAXL receptor tyrosine kinase ligand
  • DKFZp666G247
  • FLJ34709
  • Gas6
  • GAS-6
  • growth arrest-specific 6
  • growth arrest-specific protein 6

Background

GAS6 - growth arrest-specific 6

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF154
Species: Hu
Applications: WB, Flow, IHC, Block, CyTOF-ready, KO
AF591
Species: Mu
Applications: WB, Flow, CyTOF-ready
NBP1-28635
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NLS4271
Species: Hu, Rt, Mk, Pm
Applications: WB, IHC-P, IF
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-33116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15071
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-46403
Species: Hu
Applications: IHC
NBP2-46404
Species: Hu
Applications: IHC, IHC-P
NBP2-45825
Species: Hu
Applications: WB, IHC
H00054778-M05
Species: Hu
Applications: WB, ELISA, ICC/IF
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-47863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for Gas6 Partial Recombinant Protein (H00002621-Q01) (0)

There are no publications for Gas6 Partial Recombinant Protein (H00002621-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gas6 Partial Recombinant Protein (H00002621-Q01) (0)

There are no reviews for Gas6 Partial Recombinant Protein (H00002621-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Gas6 Partial Recombinant Protein (H00002621-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Gas6 Products

Bioinformatics Tool for Gas6 Partial Recombinant Protein (H00002621-Q01)

Discover related pathways, diseases and genes to Gas6 Partial Recombinant Protein (H00002621-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gas6 Partial Recombinant Protein (H00002621-Q01)

Discover more about diseases related to Gas6 Partial Recombinant Protein (H00002621-Q01).
 

Pathways for Gas6 Partial Recombinant Protein (H00002621-Q01)

View related products by pathway.

PTMs for Gas6 Partial Recombinant Protein (H00002621-Q01)

Learn more about PTMs related to Gas6 Partial Recombinant Protein (H00002621-Q01).

Blogs on Gas6

There are no specific blogs for Gas6, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Gas6 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GAS6
Entrez