GAS2 Antibody (4E11.) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related GAS2 Primary Antibodies

Order Details


    • Catalog Number
      H00002620-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GAS2 Antibody (4E11.) [PE] Summary

Immunogen
GAS2 (NP_005247, 1 a.a. - 110 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MCTALSPKVRSGPGLSDMHQYSQWLASRHEANLLPMKEDLALWLTNLLGKEITAETFMEKLDNGALLCQLAETMQEKFKESMDANKPTKNLPLKKIPCKTSAPSGSFFAR
Specificity
GAS2 (4E11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GAS2
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Reactivity Notes

Please note that this antibody is reactive to Mouse and derived from the same host, Mouse. Additional Mouse on Mouse blocking steps may be required for IHC and ICC experiments. Please contact Technical Support for more information.

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GAS2 Antibody (4E11.) [PE]

  • GAS-2
  • growth arrest-specific 2
  • growth arrest-specific protein 2
  • MGC32610

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2644
Species: Mu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), ELISA(Sta)
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
AF885
Species: Hu
Applications: WB, IHC
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32310
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-06542
Species: Hu
Applications: WB, IHC, IHC-P, IP
AF2988
Species: Mu, Rt
Applications: WB
NB110-59086
Species: Hu, Pm, Bv(-), Mu(-), Rt(-)
Applications: WB, IHC, IHC-P
NBP1-89946
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-45511
Species: Hu
Applications: WB, IHC
AF682
Species: Hu
Applications: WB, IHC, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
H00023499-M08
Species: Hu
Applications: WB, ELISA
NB100-356
Species: Hu, Rb
Applications: WB, Simple Western, B/N, ICC/IF, IHC, IHC-P
NB120-11220
Species: Hu, Mu, Rt, Ma
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr
H00002620-M01PE
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF

Publications for GAS2 Antibody (H00002620-M01PE) (0)

There are no publications for GAS2 Antibody (H00002620-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GAS2 Antibody (H00002620-M01PE) (0)

There are no reviews for GAS2 Antibody (H00002620-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GAS2 Antibody (H00002620-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GAS2 Products

Bioinformatics Tool for GAS2 Antibody (H00002620-M01PE)

Discover related pathways, diseases and genes to GAS2 Antibody (H00002620-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GAS2 Antibody (H00002620-M01PE)

Discover more about diseases related to GAS2 Antibody (H00002620-M01PE).
 

Pathways for GAS2 Antibody (H00002620-M01PE)

View related products by pathway.

PTMs for GAS2 Antibody (H00002620-M01PE)

Learn more about PTMs related to GAS2 Antibody (H00002620-M01PE).
 

Research Areas for GAS2 Antibody (H00002620-M01PE)

Find related products by research area.

Blogs on GAS2

There are no specific blogs for GAS2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GAS2 Antibody (4E11.) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol GAS2