Gankyrin Antibody (4B5) [PerCP]

Images

 

Product Details

Summary
Product Discontinued
View other related Gankyrin Primary Antibodies

Order Details


    • Catalog Number
      H00005716-M01PCP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Gankyrin Antibody (4B5) [PerCP] Summary

Immunogen
PSMD10 (AAH11960 127 a.a. - 226 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. EGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVAKGGLGLILKRMVEG
Specificity
PSMD10 - proteasome (prosome, macropain) 26S subunit, non-ATPase, 10
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
PSMD10
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Gankyrin Antibody (4B5) [PerCP]

  • 26S proteasome non-ATPase regulatory subunit 10
  • 26S proteasome regulatory subunit p28
  • ankyrin repeat protein
  • dJ889N15.2
  • gankyrin
  • hepatocellular carcinoma-associated protein p28-II
  • p28
  • p28(GANK)
  • proteasome (prosome, macropain) 26S subunit, non-ATPase, 10

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB15041
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-86784
Species: Hu
Applications: IHC, IHC-P
NBP1-92355
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
AF7250
Species: Hu
Applications: IHC
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NBP2-35172
Species: Mu
H00005716-M01PCP
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P

Publications for Gankyrin Antibody (H00005716-M01PCP) (0)

There are no publications for Gankyrin Antibody (H00005716-M01PCP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Gankyrin Antibody (H00005716-M01PCP) (0)

There are no reviews for Gankyrin Antibody (H00005716-M01PCP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Gankyrin Antibody (H00005716-M01PCP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Gankyrin Products

Bioinformatics Tool for Gankyrin Antibody (H00005716-M01PCP)

Discover related pathways, diseases and genes to Gankyrin Antibody (H00005716-M01PCP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Gankyrin Antibody (H00005716-M01PCP)

Discover more about diseases related to Gankyrin Antibody (H00005716-M01PCP).
 

Pathways for Gankyrin Antibody (H00005716-M01PCP)

View related products by pathway.

PTMs for Gankyrin Antibody (H00005716-M01PCP)

Learn more about PTMs related to Gankyrin Antibody (H00005716-M01PCP).
 

Research Areas for Gankyrin Antibody (H00005716-M01PCP)

Find related products by research area.

Blogs on Gankyrin

There are no specific blogs for Gankyrin, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Gankyrin Antibody (4B5) [PerCP] and receive a gift card or discount.

Bioinformatics

Gene Symbol PSMD10