Recombinant Human GALNT14 Protein

Images

 

Product Details

Summary
Product Discontinued
View other related GALNT14 Peptides and Proteins

Order Details


    • Catalog Number
      H00079623-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human GALNT14 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 494-551 of Human GALNT14 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:KNGDDRQQWTKTGSHIEHIASHLCLDTDMFGDGTENGKEIVVNPCESSLMSQHWDMVS

Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
GALNT14

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GALNT14 Protein

  • EC 2.4.1.41
  • FLJ12691
  • FLJ13977
  • GalNac-T10
  • GalNac-T14
  • GALNT14
  • GALNT15
  • Polypeptide GalNAc transferase 14
  • polypeptide N-acetylgalactosaminyltransferase 14
  • polypeptide N-acetylgalactosaminyltransferase 15
  • pp-GaNTase 14
  • Protein-UDP acetylgalactosaminyltransferase 14
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 14
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase T10
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase T14
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 14 (GalNAc-T14)

Background

GALNT14 (EC 2.4.1.41) belongs to a large subfamily of glycosyltransferases residing in the Golgi apparatus. GALNT enzymes catalyze the first step in the O-glycosylation of mammalian proteins by transferring N-acetyl-D-galactosamine (GalNAc) to peptide substrates.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29461
Species: Hu, Bv(-), Ca(-), Ha(-), Mu(-), Po(-), Rt(-), Sh(-)
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-89726
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
8905-GT
Species: Hu
NBP2-49118
Species: Hu
Applications: IHC, IHC-P
NBP2-09728
Species: Hu
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81848
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-31864
Species: Hu
Applications: IHC, IHC-P
NB600-844
Species: Hu, Mu, Rt, Ch, Rb
Applications: WB, IHC, IHC-Fr, IHC-P, IF
AF8221
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC

Publications for GALNT14 Partial Recombinant Protein (H00079623-Q01) (0)

There are no publications for GALNT14 Partial Recombinant Protein (H00079623-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALNT14 Partial Recombinant Protein (H00079623-Q01) (0)

There are no reviews for GALNT14 Partial Recombinant Protein (H00079623-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GALNT14 Partial Recombinant Protein (H00079623-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GALNT14 Products

Bioinformatics Tool for GALNT14 Partial Recombinant Protein (H00079623-Q01)

Discover related pathways, diseases and genes to GALNT14 Partial Recombinant Protein (H00079623-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALNT14 Partial Recombinant Protein (H00079623-Q01)

Discover more about diseases related to GALNT14 Partial Recombinant Protein (H00079623-Q01).
 

Pathways for GALNT14 Partial Recombinant Protein (H00079623-Q01)

View related products by pathway.

PTMs for GALNT14 Partial Recombinant Protein (H00079623-Q01)

Learn more about PTMs related to GALNT14 Partial Recombinant Protein (H00079623-Q01).

Blogs on GALNT14

There are no specific blogs for GALNT14, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GALNT14 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT14
Entrez