Recombinant Human GALNT13 Protein

Images

 
SDS-Page: Recombinant Human GALNT13 Protein [H00114805-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human GALNT13 Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 556 of Human GALNT13 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MRRSVYCKVVLATSLMWVLVDVFLLLYFSECNKCDDKKERSLLPALRAVISRNQEGPGEMGKAVLIPKDDQEKMKELFKINQFNLMASDLIALNRSLPDVRLEGCKTKVYPDELPNTSVVIVFHNEAWSTLLRTVYSVINRSPHYLLSEVILVDDASERDFLKLTLENYVKNLEVPVKIIRMEERSGLIRARLRGAAASKGQVITFLDAHCECTLGWLEPLLARIKEDRKTVVCPIIDVISDDTFEYMAGSDMTYGGFNWKLNFRWYPVPQREMDRRKGDRTLPVRTPTMAGGLFSIDRNYFEEIGTYDAGMDIWGGENLEMSFRIWQCGGSLEIVTCSHVGHVFRKATPYTFPGGTGHVINKNNRRLAEVWMDEFKDFFYIISPGVVKVDYGDVSVRKTLRENLKCKPFSWYLENIYPDSQIPRRYYSLGEIRNVETNQCLDNMGRKENEKVGIFNCHGMGGNQVFSYTADKEIRTDDLCLDVSRLNGPVIMLKCHHMRGNQLWEYDAERLTLRHVNSNQCLDEPSEEDKMVPTMQDCSGSRSQQWLLRNMTLGT

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
GALNT13

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GALNT13 Protein

  • Acetylgalactosaminyltransferase 13
  • EC 2.4.1.41
  • FLJ16031
  • FLJ41157
  • GalNAc transferase 13
  • GalNAc-T13
  • GalNAc-T13MGC119459
  • GALNT13
  • KIAA1918H_NH0187G20.1
  • MGC119461
  • Polypeptide GalNAc transferase 13
  • polypeptide N-acetylgalactosaminyltransferase 13
  • Pp-GaNTase 13
  • Protein-UDP acetylgalactosaminyltransferase 13
  • UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 13
  • UDP-N-acetyl-alpha-D-galactosamine:polypeptideN-acetylgalactosaminyltransferase 13 (GalNAc-T13)
  • WUGSC:H_NH0187G20.1

Background

The GALNT13 protein is a member of the UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase (GalNAcT; EC 2.4.1.41) family, which initiate O-linked glycosylation of mucins (see MUC3A, MIM 158371) by the initial transfer of N-acetylgalactosamine (GalNAc) with an alpha-linkage to a serine or threonine residue.[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41312
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7550
Species: Hu
Applications: WB
NB400-156
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IP, CyTOF-ready
NBP1-88066
Species: Hu
Applications: IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
MAB25031
Species: Hu
Applications: WB, IHC, IP
NB300-109
Species: Hu, Mu, Rt, Dr, I, Ma
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP1-84758
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF-242-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP1-77347
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
9077-GT
Species: Hu
H00064326-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF
NBP1-89883
Species: Hu
Applications: WB, IHC, IHC-P
AF2599
Species: Hu
Applications: WB, Simple Western, IHC

Publications for GALNT13 Recombinant Protein (H00114805-P01) (0)

There are no publications for GALNT13 Recombinant Protein (H00114805-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALNT13 Recombinant Protein (H00114805-P01) (0)

There are no reviews for GALNT13 Recombinant Protein (H00114805-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GALNT13 Recombinant Protein (H00114805-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GALNT13 Products

Bioinformatics Tool for GALNT13 Recombinant Protein (H00114805-P01)

Discover related pathways, diseases and genes to GALNT13 Recombinant Protein (H00114805-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALNT13 Recombinant Protein (H00114805-P01)

Discover more about diseases related to GALNT13 Recombinant Protein (H00114805-P01).
 

Pathways for GALNT13 Recombinant Protein (H00114805-P01)

View related products by pathway.

PTMs for GALNT13 Recombinant Protein (H00114805-P01)

Learn more about PTMs related to GALNT13 Recombinant Protein (H00114805-P01).

Blogs on GALNT13

There are no specific blogs for GALNT13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GALNT13 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GALNT13
Entrez