GALE Antibody

Images

 
Western Blot: GALE Antibody [NBP1-55139] - Human Liver cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Product Discontinued
View other related GALE Primary Antibodies

Order Details


    • Catalog Number
      NBP1-55139
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GALE Antibody Summary

Immunogen
Synthetic peptides corresponding to GALE(UDP-galactose-4-epimerase) The peptide sequence was selected from the N terminal of GALE. Peptide sequence AEKVLVTGGAGYIGSHTVLELLEAGYLPVVIDNFHNAFRGGGSLPESLRR.
Clonality
Polyclonal
Host
Rabbit
Gene
GALE
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.2-1 ug/ml
Application Notes
This is a rabbit polyclonal antibody against GALE and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GALE Antibody

  • EC 5.1.3
  • EC 5.1.3.2
  • FLJ95174
  • FLJ97302
  • Galactowaldenase
  • short chain dehydrogenase/reductase family 1E, member 1
  • UDP galactose-4'-epimerase
  • UDP-
  • UDP-galactose 4-epimerase
  • UDP-galactose-4-epimerase
  • UDP-glucose 4-epimerase

Background

GALE is an UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation, with symptoms ranging from mild ('peripheral' form) to severe ('generalized' form). This gene encodes UDP-galactose-4-epimerase which catalyzes two distinct but analogous reactions: the epimerization of UDP-glucose to UDP-galactose, and the epimerization of UDP-N-acetylglucosamine to UDP-N-acetylgalactosamine. The bifunctional nature of the enzyme has the important metabolic consequence that mutant cells (or individuals) are dependent not only on exogenous galactose, but also on exogenous N-acetylgalactosamine as a necessary precursor for the synthesis of glycoproteins and glycolipids. Mutations in this gene result in epimerase-deficiency galactosemia, also referred to as galactosemia type 3, a disease characterized by liver damage, early-onset cataracts, deafness and mental retardation, with symptoms ranging from mild ('peripheral' form) to severe ('generalized' form). Multiple alternatively spliced transcripts encoding the same protein have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-81853
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00002592-M01
Species: Hu, Rt
Applications: WB, ELISA, IHC-P
NBP2-33582
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-82693
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-57614
Species: Hu
Applications: ICC/IF
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59448
Species: Hu
Applications: WB
NBP2-30949
Species: Hu
Applications: IHC, IHC-P
NBP1-97512
Species: Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-81293
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-49365
Species: Hu
Applications: ICC/IF, IHC
NBP2-25238
Species: Hu
Applications: Flow, ICC/IF, IHC-P, PAGE
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC-P
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5447
Species: Hu
Applications: WB, CyTOF-ready, ICFlow
NBP1-91823
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-33736
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-55139
Species: Hu
Applications: WB

Publications for GALE Antibody (NBP1-55139) (0)

There are no publications for GALE Antibody (NBP1-55139).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GALE Antibody (NBP1-55139) (0)

There are no reviews for GALE Antibody (NBP1-55139). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GALE Antibody (NBP1-55139) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GALE Products

Bioinformatics Tool for GALE Antibody (NBP1-55139)

Discover related pathways, diseases and genes to GALE Antibody (NBP1-55139). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GALE Antibody (NBP1-55139)

Discover more about diseases related to GALE Antibody (NBP1-55139).
 

Pathways for GALE Antibody (NBP1-55139)

View related products by pathway.

PTMs for GALE Antibody (NBP1-55139)

Learn more about PTMs related to GALE Antibody (NBP1-55139).
 

Research Areas for GALE Antibody (NBP1-55139)

Find related products by research area.

Blogs on GALE

There are no specific blogs for GALE, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GALE Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GALE
Uniprot