Recombinant Human GADD45 alpha Protein

Images

 

Product Details

Summary
Product Discontinued
View other related GADD45 alpha Peptides and Proteins

Order Details


    • Catalog Number
      H00001647-Q01
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

Recombinant Human GADD45 alpha Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-90 of Human GADD45A partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:TLIQAFCCENDINILRVSNPGRLAELLLLETDAGPAASEGAEQPPDLHCVLVTNPHSSQWKDPALSQLICFCRESRYMDQWVPVINLPER

Protein/Peptide Type
Partial Recombinant Protein
Gene
GADD45A

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Reactivity Notes

Human

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human GADD45 alpha Protein

  • DDIT-1
  • DDIT1growth arrest and DNA damage-inducible protein GADD45 alpha
  • DNA damage-inducible transcript 1 protein
  • DNA damage-inducible transcript-1
  • GADD45 alpha
  • GADD45a
  • GADD45DNA-damage-inducible transcript 1
  • growth arrest and DNA-damage-inducible 45 alpha
  • growth arrest and DNA-damage-inducible, alpha

Background

GADD45A - growth arrest and DNA-damage-inducible, alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF6897
Species: Hu, Mu
Applications: WB, IHC
NBP1-87990
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1335
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, GS, ICC/IF, IHC, IHC-P, IP
NB500-106
Species: Hu, Mu, Rt, Po, Ch, Dr, Fi, Pm, Rb, Ye, Ze
Applications: WB, Simple Western, ChIP, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
H00056996-R01
Species: Hu
NB100-2736
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-84385
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-28566
Species: Hu, Mu, Rt, Bv, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB500-138
Species: Hu
Applications: WB, IHC, IHC-P

Publications for GADD45 alpha Partial Recombinant Protein (H00001647-Q01) (0)

There are no publications for GADD45 alpha Partial Recombinant Protein (H00001647-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GADD45 alpha Partial Recombinant Protein (H00001647-Q01) (0)

There are no reviews for GADD45 alpha Partial Recombinant Protein (H00001647-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GADD45 alpha Partial Recombinant Protein (H00001647-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional GADD45 alpha Products

Bioinformatics Tool for GADD45 alpha Partial Recombinant Protein (H00001647-Q01)

Discover related pathways, diseases and genes to GADD45 alpha Partial Recombinant Protein (H00001647-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GADD45 alpha Partial Recombinant Protein (H00001647-Q01)

Discover more about diseases related to GADD45 alpha Partial Recombinant Protein (H00001647-Q01).
 

Pathways for GADD45 alpha Partial Recombinant Protein (H00001647-Q01)

View related products by pathway.

PTMs for GADD45 alpha Partial Recombinant Protein (H00001647-Q01)

Learn more about PTMs related to GADD45 alpha Partial Recombinant Protein (H00001647-Q01).
 

Research Areas for GADD45 alpha Partial Recombinant Protein (H00001647-Q01)

Find related products by research area.

Blogs on GADD45 alpha

There are no specific blogs for GADD45 alpha, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human GADD45 alpha Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol GADD45A
Entrez