GADD153/CHOP Antibody

Images

 
Western Blot: GADD153/CHOP Antibody [H00001649-B02P] - Analysis of DDIT3 expression in transfected 293T cell line by DDIT3 polyclonal antibody. Lane 1: DDIT3 transfected lysate(19.20 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GADD153/CHOP Antibody Summary

Immunogen
DDIT3 (AAH03637.1, 1 a.a. - 169 a.a.) full-length human protein. MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSLAQEEEEEDQGRTRKRKQSGHSPARAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA
Marker
ER Stress Marker
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
DDIT3
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and Functional.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GADD153/CHOP Antibody

  • C/EBP-homologous protein 10
  • C/EBP-homologous protein
  • CCAAT/enhancer-binding protein homologous protein
  • CEBP zeta
  • CHOP
  • CHOP10 CEBPZ
  • CHOP10
  • CHOP-10
  • CHOPC/EBP zeta
  • DDIT3
  • DDIT-3
  • DNA damage-inducible transcript 3 protein
  • DNA-damage-inducible transcript 3
  • GADD153
  • Growth arrest and DNA damage-inducible protein GADD153

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
H00001649-B02P
Species: Hu
Applications: WB

Publications for CHOP/GADD153 Antibody (H00001649-B02P) (0)

There are no publications for CHOP/GADD153 Antibody (H00001649-B02P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for CHOP/GADD153 Antibody (H00001649-B02P) (0)

There are no reviews for CHOP/GADD153 Antibody (H00001649-B02P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for CHOP/GADD153 Antibody (H00001649-B02P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GADD153/CHOP Products

Bioinformatics Tool for CHOP/GADD153 Antibody (H00001649-B02P)

Discover related pathways, diseases and genes to CHOP/GADD153 Antibody (H00001649-B02P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for CHOP/GADD153 Antibody (H00001649-B02P)

Discover more about diseases related to CHOP/GADD153 Antibody (H00001649-B02P).
 

Pathways for CHOP/GADD153 Antibody (H00001649-B02P)

View related products by pathway.

PTMs for CHOP/GADD153 Antibody (H00001649-B02P)

Learn more about PTMs related to CHOP/GADD153 Antibody (H00001649-B02P).
 

Research Areas for CHOP/GADD153 Antibody (H00001649-B02P)

Find related products by research area.

Blogs on GADD153/CHOP

There are no specific blogs for GADD153/CHOP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GADD153/CHOP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DDIT3
Entrez
Uniprot