GADD153/CHOP Antibody (2G3)

Images

 
Sandwich ELISA: GADD153/CHOP Antibody (2G3) [H00001649-M01] - Detection limit for recombinant GST tagged DDIT3 is approximately 0.03ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
2G3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

GADD153/CHOP Antibody (2G3) Summary

Immunogen
DDIT3 (AAH03637, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEESKIFTTLDPASLAWLTEEEPEPAEVTSTSQSPHSPDSSQSSL
Marker
ER Stress Marker
Specificity
DDIT3 - DNA-damage-inducible transcript 3
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
DDIT3
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.
Publications
Read Publication using H00001649-M01.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GADD153/CHOP Antibody (2G3)

  • C/EBP-homologous protein 10
  • C/EBP-homologous protein
  • CCAAT/enhancer-binding protein homologous protein
  • CEBP zeta
  • CHOP
  • CHOP10 CEBPZ
  • CHOP10
  • CHOP-10
  • CHOPC/EBP zeta
  • DDIT3
  • DDIT-3
  • DNA damage-inducible transcript 3 protein
  • DNA-damage-inducible transcript 3
  • GADD153
  • Growth arrest and DNA damage-inducible protein GADD153

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-06274
Species: Hu, Mu, Rt, Ch, Dr, Sh
Applications: WB, Simple Western, Flow, ICC/IF
NB100-80861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF1543
Species: Hu
Applications: WB, IHC
NBP1-40256
Species: Hu, Mu, Rt, Fi, Ha, Rb
Applications: WB, ChIP, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready
H00000468-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-56708
Species: Hu, Mu, Rt, Po, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready
NBP1-78017
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-85699
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-565
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NB100-56618
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-26612
Species: Hu
Applications: IP (-), WB
H00001649-M01
Species: Hu
Applications: WB, ELISA

Publications for GADD153/CHOP Antibody (H00001649-M01)(1)

Reviews for GADD153/CHOP Antibody (H00001649-M01) (0)

There are no reviews for GADD153/CHOP Antibody (H00001649-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GADD153/CHOP Antibody (H00001649-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GADD153/CHOP Products

Bioinformatics Tool for GADD153/CHOP Antibody (H00001649-M01)

Discover related pathways, diseases and genes to GADD153/CHOP Antibody (H00001649-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GADD153/CHOP Antibody (H00001649-M01)

Discover more about diseases related to GADD153/CHOP Antibody (H00001649-M01).
 

Pathways for GADD153/CHOP Antibody (H00001649-M01)

View related products by pathway.

PTMs for GADD153/CHOP Antibody (H00001649-M01)

Learn more about PTMs related to GADD153/CHOP Antibody (H00001649-M01).
 

Research Areas for GADD153/CHOP Antibody (H00001649-M01)

Find related products by research area.

Blogs on GADD153/CHOP

There are no specific blogs for GADD153/CHOP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GADD153/CHOP Antibody (2G3) and receive a gift card or discount.

Bioinformatics

Gene Symbol DDIT3
Entrez
OMIM
Uniprot