GABARAP Antibody

Images

 
Western Blot: GABARAP Antibody [NBP1-53099] - 721_B cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GABARAP Antibody Summary

Immunogen
Synthetic peptides corresponding to GABARAP(GABA(A) receptor-associated protein) The peptide sequence was selected from the N terminal of GABARAP. Peptide sequence KFVYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLDKKKYLV.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABARAP
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against GABARAP and was validated on Western blot.
Theoretical MW
14 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for GABARAP Antibody

  • Apg8p1
  • ATG8A
  • FLC3B
  • FLJ25768
  • GABA(A) receptor-associated proteinMGC120154
  • GABARAP
  • gamma-aminobutyric acid receptor-associated protein
  • MM46
  • MM46MGC120155

Background

Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. GABA(A) receptor-associated protein (GABARAP) is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. Gamma-aminobutyric acid A receptors [GABA(A) receptors] are ligand-gated chloride channels that mediate inhibitory neurotransmission. This gene encodes GABA(A) receptor-associated protein, which is highly positively charged in its N-terminus and shares sequence similarity with light chain-3 of microtubule-associated proteins 1A and 1B. This protein clusters neurotransmitter receptors by mediating interaction with the cytoskeleton. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-88883
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-55202
Species: Hu
Applications: WB, IHC, IHC-P
NB100-2331
Species: Hu, Mu, Rt, Ca, Fi, Pl, Ze
Applications: WB, Simple Western, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, SB
NBP1-87035
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03449
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00008878-M01
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IP
H00002965-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-85091
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37399
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NB200-335
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-02627
Species: Hu, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-19151
Species: Hu, Ma
Applications: WB, IHC-P, IP
NBP2-24709
Species: Hu, Mu, Rt
Applications: WB, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NB600-101
Species: Hu, Mu, Rt, Bv, Ha, Pm
Applications: WB, Simple Western, B/N, DB, EM, ICC/IF, IHC, IHC-P, IP, PA
MAB6608
Species: Hu, Mu
Applications: WB, Simple Western, IHC, CyTOF-ready, ICC, ICFlow

Publications for GABARAP Antibody (NBP1-53099) (0)

There are no publications for GABARAP Antibody (NBP1-53099).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABARAP Antibody (NBP1-53099) (0)

There are no reviews for GABARAP Antibody (NBP1-53099). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GABARAP Antibody (NBP1-53099) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GABARAP Products

Bioinformatics Tool for GABARAP Antibody (NBP1-53099)

Discover related pathways, diseases and genes to GABARAP Antibody (NBP1-53099). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABARAP Antibody (NBP1-53099)

Discover more about diseases related to GABARAP Antibody (NBP1-53099).
 

Pathways for GABARAP Antibody (NBP1-53099)

View related products by pathway.

PTMs for GABARAP Antibody (NBP1-53099)

Learn more about PTMs related to GABARAP Antibody (NBP1-53099).
 

Research Areas for GABARAP Antibody (NBP1-53099)

Find related products by research area.

Blogs on GABARAP.

Breakdown: Interpreting LC3 Antibody WB Results
In rodents, MAPLC3 (Microtubule-associated protein 1 light chain 3) is expressed in the renal visceral epithelial cells, or podocytes. LC3 antibody analysis has shown the protein accumulates in its membrane-bound form of LC3II, following conversion fr...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABARAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABARAP
Entrez
Uniprot