GABA Transporter 2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: GABA Transporter 2 Antibody [NBP2-33664] - Staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: GABA Transporter 2 Antibody [NBP2-33664] - Staining of human kidney shows strong cytoplasmic positivity in distal renal tubules.

Product Details

Summary
Product Discontinued
View other related GABA Transporter 2 Primary Antibodies

Order Details


    • Catalog Number
      NBP2-33664
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GABA Transporter 2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: YLFSSFTIDLPWGGCYHEWNTEHCMEFQKTNGSLNGTSENAT
Specificity
Specificity of human GABA Transporter 2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SLC6A13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Reactivity Notes

Expected species cross reactivity based on sequence homology: Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GABA Transporter 2 Antibody

  • GABA transport protein
  • GAT-2
  • GAT2Solute carrier family 6 member 13
  • sodium- and chloride-dependent GABA transporter 2
  • solute carrier family 6 (neurotransmitter transporter, GABA), member 13

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89802
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-91920
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-88641
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-55298
Species: Hu
Applications: WB, IHC, IHC-P
NB110-41404
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC
NBP1-60120
Species: Hu
Applications: WB, TCS
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84299
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14245
Species: Hu
Applications: IHC, IHC-P
AF2086
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-21598
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-92396
Species: Hu
Applications: IHC, IHC-P
NBP1-88872
Species: Hu
Applications: IHC, IHC-P
NBP1-89327
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-20857
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-65203
Species: Hu
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33664
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for GABA Transporter 2 Antibody (NBP2-33664) (0)

There are no publications for GABA Transporter 2 Antibody (NBP2-33664).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA Transporter 2 Antibody (NBP2-33664) (0)

There are no reviews for GABA Transporter 2 Antibody (NBP2-33664). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for GABA Transporter 2 Antibody (NBP2-33664) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for GABA Transporter 2 Antibody (NBP2-33664)

Discover related pathways, diseases and genes to GABA Transporter 2 Antibody (NBP2-33664). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA Transporter 2 Antibody (NBP2-33664)

Discover more about diseases related to GABA Transporter 2 Antibody (NBP2-33664).
 

Pathways for GABA Transporter 2 Antibody (NBP2-33664)

View related products by pathway.

PTMs for GABA Transporter 2 Antibody (NBP2-33664)

Learn more about PTMs related to GABA Transporter 2 Antibody (NBP2-33664).
 

Research Areas for GABA Transporter 2 Antibody (NBP2-33664)

Find related products by research area.

Blogs on GABA Transporter 2

There are no specific blogs for GABA Transporter 2, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABA Transporter 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SLC6A13
Uniprot