GABA-B R1 Antibody (2D7) [PE]

Images

 

Product Details

Summary
Product Discontinued
View other related GABA-B R1 Primary Antibodies

Order Details


    • Catalog Number
      H00002550-M01PE
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

GABA-B R1 Antibody (2D7) [PE] Summary

Immunogen
GABBR1 (AAH50532, 52 a.a. - 151 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. AVYIGALFPMSGGWPGGQACQPAVEMALEDVNSRRDILPDYELKLIHHDSKCDPGQATKYLYELLYNDPIKIILMPGCSSVSTLVAEAARMWNLIVLSYG
Specificity
GABBR1 - gamma-aminobutyric acid (GABA) B receptor, 1
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
GABBR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence

Packaging, Storage & Formulations

Storage
Store at 4C in the dark.
Buffer
PBS
Preservative
0.05% Sodium Azide
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for GABA-B R1 Antibody (2D7) [PE]

  • FLJ92613
  • GABA B R1
  • GABABR1
  • GABBR1
  • GABBR1-3
  • gamma-aminobutyric acid (GABA) B receptor, 1
  • gamma-aminobutyric acid type B receptor subunit 1
  • Gb1
  • GPRC3A
  • GPRC3Asubunit 1c
  • hGB1a
  • seven transmembrane helix receptor

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1188
Species: Rt
Applications: WB, IHC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NB300-605
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-59537
Species: Hu
Applications: WB, ICC/IF, IHC
NBP1-33284
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-46198
Species: Hu
Applications: WB, IHC
H00003126-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NB100-64775
Species: Hu, Bb, Bv, Pm
Applications: ELISA, Flow, Func, ICC/IF, IHC, IHC-Fr, IP
NBP2-20231
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80061
Species: Hu
Applications: WB, IHC
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NB110-39033
Species: Hu, Mu, Rt, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NLS418
Species: Hu
Applications: IHC-P
NBP2-47415
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB8458
Species: Hu
Applications: Flow, CyTOF-ready, ICC

Publications for GABA-B R1 Antibody (H00002550-M01PE) (0)

There are no publications for GABA-B R1 Antibody (H00002550-M01PE).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-B R1 Antibody (H00002550-M01PE) (0)

There are no reviews for GABA-B R1 Antibody (H00002550-M01PE). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GABA-B R1 Antibody (H00002550-M01PE) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GABA-B R1 Products

Bioinformatics Tool for GABA-B R1 Antibody (H00002550-M01PE)

Discover related pathways, diseases and genes to GABA-B R1 Antibody (H00002550-M01PE). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA-B R1 Antibody (H00002550-M01PE)

Discover more about diseases related to GABA-B R1 Antibody (H00002550-M01PE).
 

Pathways for GABA-B R1 Antibody (H00002550-M01PE)

View related products by pathway.

Research Areas for GABA-B R1 Antibody (H00002550-M01PE)

Find related products by research area.

Blogs on GABA-B R1

There are no specific blogs for GABA-B R1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABA-B R1 Antibody (2D7) [PE] and receive a gift card or discount.

Bioinformatics

Gene Symbol GABBR1
Entrez