GABA-A R beta 2 Antibody - BSA Free

Western Blot: GABA-A R beta 2 Antibody [NBP2-88824] - WB Suggested Anti-GABRB2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: HepG2 cell lysate

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

GABA-A R beta 2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of human GABA-A R beta 2. Peptide sequence: HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: GABRB2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for GABA-A R beta 2 Antibody - BSA Free

• GABA A R beta 2
• GABA(A) receptor subunit beta-2
• GABAAR beta 2
• GABAARb2
• GABRB2
• gamma-aminobutyric acid (GABA) A receptor, beta 2
• gamma-aminobutyric acid A receptor beta 2
• gamma-aminobutyric acid receptor subunit beta-2
• MGC119386
• MGC119388
• MGC119389

Background

GABA (A) receptors are ligand-gated chloride channels that play a role as inhibitory neurotransmitters. They are known targets for certain classes of environmental and pharmaceutical compounds because a number of drugs interact with binding sites on GABA (A). Some of these drugs include benzodiazepines, anticonvulsants, and anesthetics. GABA (A) Receptors are comprised of subunits and these are further classified into 3 major groups (alpha, beta, and gamma). The subunits determine the pharmacological characteristics.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: GABRB2