GABA-A R beta 2 Antibody

Images

 
Western Blot: GABA-A R beta 2 Antibody [NBP2-88824] - WB Suggested Anti-GABRB2 Antibody Titration: 0.2-1 ug/ml. ELISA Titer: 1:12500. Positive Control: HepG2 cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GABA-A R beta 2 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human GABA-A R beta 2. Peptide sequence: HPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYW The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
GABRB2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GABA-A R beta 2 Antibody

  • GABA A R beta 2
  • GABA(A) receptor subunit beta-2
  • GABAAR beta 2
  • GABAARb2
  • GABRB2
  • gamma-aminobutyric acid (GABA) A receptor, beta 2
  • gamma-aminobutyric acid A receptor beta 2
  • gamma-aminobutyric acid receptor subunit beta-2
  • MGC119386
  • MGC119388
  • MGC119389

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-191
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IP, KO, WB
NB300-190
Species: Hu, Mu, Rt
Applications: IHC, KD, WB
NB300-196
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, KO, WB
NB300-199
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
NBP1-33284
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-59325
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP2-38449
Species: Hu
Applications: ICC/IF, IHC, IHC-P
640-A3
Species: Mu
Applications: Bind
NBP1-48272
Species: Hu, Pm, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
NBP2-75497
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-88927
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-88191
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00728695-B01P
Species: Hu
Applications: ICC/IF, IP, WB
NBP2-75496
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC-P, WB
NBP1-43435
Species: Hu, Mu
Applications: Flow, WB
NBP3-05546
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, WB
NBP2-88824
Species: Hu
Applications: WB

Publications for GABA-A R beta 2 Antibody (NBP2-88824) (0)

There are no publications for GABA-A R beta 2 Antibody (NBP2-88824).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for GABA-A R beta 2 Antibody (NBP2-88824) (0)

There are no reviews for GABA-A R beta 2 Antibody (NBP2-88824). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for GABA-A R beta 2 Antibody (NBP2-88824) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GABA-A R beta 2 Products

Bioinformatics Tool for GABA-A R beta 2 Antibody (NBP2-88824)

Discover related pathways, diseases and genes to GABA-A R beta 2 Antibody (NBP2-88824). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA-A R beta 2 Antibody (NBP2-88824)

Discover more about diseases related to GABA-A R beta 2 Antibody (NBP2-88824).
 

Pathways for GABA-A R beta 2 Antibody (NBP2-88824)

View related products by pathway.

PTMs for GABA-A R beta 2 Antibody (NBP2-88824)

Learn more about PTMs related to GABA-A R beta 2 Antibody (NBP2-88824).
 

Research Areas for GABA-A R beta 2 Antibody (NBP2-88824)

Find related products by research area.

Blogs on GABA-A R beta 2

There are no specific blogs for GABA-A R beta 2, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABA-A R beta 2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABRB2