GABA A R alpha 3 Antibody

Images

 
Western Blot: GABA A R alpha 3 Antibody [NBP1-87499] - Analysis in human cell line U-87 MG.
Immunocytochemistry/ Immunofluorescence: GABA A R alpha 3 Antibody [NBP1-87499] - Staining of mouse thalamus shows strong positivity in the paraventricular thalamic nucleus.
Immunohistochemistry-Paraffin: GABA A R alpha 3 Antibody [NBP1-87499] - Staining of human duodenum shows distinct membranous positivity in glandular cells.
Western Blot: GABA A R alpha 3 Antibody [NBP1-87499] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/ Immunofluorescence: GABA A R alpha 3 Antibody [NBP1-87499] - Staining of mouse ventral pallidum shows strong labeling of synaptic fields.
Immunocytochemistry/ Immunofluorescence: GABA A R alpha 3 Antibody [NBP1-87499] - Staining of mouse olfactory bulb shows labelling of both neurons and synapses.
Immunocytochemistry/ Immunofluorescence: GABA A R alpha 3 Antibody [NBP1-87499] - Staining of mouse insular cortex shows strong immunoreactivity in synapses.
Immunohistochemistry-Paraffin: GABA A R alpha 3 Antibody [NBP1-87499] - Staining of human cerebral cortex shows strong cytoplasmic and nuclear positivity in neuronal cells and glial cells.
Immunohistochemistry-Paraffin: GABA A R alpha 3 Antibody [NBP1-87499] - Staining of human cerebral cortex shows moderate immunoreactivity in neuropil.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

GABA A R alpha 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:TSHCYMTSLGILFLINILPGTTGQGESRRQEPGDFVKQDIGGLSPKHAPDIPDDSTDNITIFTRILDRLLDGYDNRLRPGLGDAVTEVKTDIYVTSFGPVSDTDMEYTIDVFFRQTWHDE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
GABRA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Control Peptide
GABA A R alpha 3 Protein (NBP1-87499PEP)
Publications
Read Publication using NBP1-87499.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for GABA A R alpha 3 Antibody

  • GABA A R alpha 3
  • GABA(A) receptor subunit alpha-3
  • GABAARa3
  • GABRA3
  • gamma-aminobutyric acid (GABA) A receptor, alpha 3
  • gamma-aminobutyric acid receptor subunit alpha-3
  • gamma-animobutyric acid (GABA) A receptor, alpha 3
  • MGC33793

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-36560
Species: Mu, Rt
Applications: WB, IHC
NB300-191
Species: Hu, Mu, Rt
Applications: WB
NBL1-07321
Species: Hu
NB300-199
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IF, IHC-FrFl
NBP1-84956
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-236
Species: Hu, Mu
Applications: WB, IB, IHC, IHC-Fr, IHC-P, IP
NBP2-02149
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-89333
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP1-84957
Species: Hu
Applications: WB, IHC, IHC-P
H00000518-R01
Species: Hu
NBP1-32870
Species: Hu, Ch
Applications: WB, IHC, IHC-P, IP
NB300-195
Species: Mu, Rt
Applications: WB, IHC
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA

Publications for GABA A R alpha 3 Antibody (NBP1-87499)(1)

Reviews for GABA A R alpha 3 Antibody (NBP1-87499) (0)

There are no reviews for GABA A R alpha 3 Antibody (NBP1-87499). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for GABA A R alpha 3 Antibody (NBP1-87499) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional GABA A R alpha 3 Products

Bioinformatics Tool for GABA A R alpha 3 Antibody (NBP1-87499)

Discover related pathways, diseases and genes to GABA A R alpha 3 Antibody (NBP1-87499). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for GABA A R alpha 3 Antibody (NBP1-87499)

Discover more about diseases related to GABA A R alpha 3 Antibody (NBP1-87499).
 

Pathways for GABA A R alpha 3 Antibody (NBP1-87499)

View related products by pathway.

PTMs for GABA A R alpha 3 Antibody (NBP1-87499)

Learn more about PTMs related to GABA A R alpha 3 Antibody (NBP1-87499).

Blogs on GABA A R alpha 3

There are no specific blogs for GABA A R alpha 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our GABA A R alpha 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol GABRA3
Entrez
Uniprot