G5pr Antibody

Images

 
Western Blot: G5pr Antibody [NBP2-87480] - Host: Rabbit. Target Name: PPP2R3C. Sample Tissue: Human 786-0 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

G5pr Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human G5pr. Peptide sequence: TKYYSEWKGGRKNTNEFYKTIPRFYYRLPAEDEVLLQKLREESRAVFLQR The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
PPP2R3C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for G5pr Antibody

  • C14orf10
  • chromosome 14 open reading frame 10
  • FLJ20644
  • G4-1
  • G5pr
  • protein phosphatase 2 (formerly 2A), regulatory subunit B'', gamma
  • protein phosphatase 2, regulatory subunit B'', gamma
  • Protein phosphatase subunit G5PR
  • rhabdomyosarcoma antigen MU-RMS-40.6A
  • Rhabdomyosarcoma antigen MU-RMS-40.6A/6C
  • rhabdomyosarcoma antigen Mu-RMS-40.6C
  • serine/threonine-protein phosphatase 2A regulatory subunit B'' subunit gamma

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-76963
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ELISA, IHC, IHC-P, IF
MAB17761
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP1-83393
Species: Hu
Applications: WB, ICC/IF
NBP1-47927
Species: Hu, Mu, Rt, Ca, Pm, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF2545
Species: Hu
Applications: WB, IP, Neut
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
6507-IL/CF
Species: Hu
H00005729-B01P
Species: Hu
Applications: WB, Flow, ICC/IF
NB100-56583
Species: Hu, Rt, Rb
Applications: WB, Flow, IHC, IHC-P, KO
AF123
Species: Hu
Applications: WB, Block, ICC
NB100-56749
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P
NBP1-19098
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
H00000894-B01P
Species: Hu, Rt
Applications: WB
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB120-6405
Species: Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, B/N, CyTOF-ready, Flow-IC
NBP2-87480
Species: Hu
Applications: WB

Publications for G5pr Antibody (NBP2-87480) (0)

There are no publications for G5pr Antibody (NBP2-87480).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for G5pr Antibody (NBP2-87480) (0)

There are no reviews for G5pr Antibody (NBP2-87480). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G5pr Antibody (NBP2-87480) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional G5pr Products

Bioinformatics Tool for G5pr Antibody (NBP2-87480)

Discover related pathways, diseases and genes to G5pr Antibody (NBP2-87480). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G5pr Antibody (NBP2-87480)

Discover more about diseases related to G5pr Antibody (NBP2-87480).
 

Pathways for G5pr Antibody (NBP2-87480)

View related products by pathway.

PTMs for G5pr Antibody (NBP2-87480)

Learn more about PTMs related to G5pr Antibody (NBP2-87480).

Blogs on G5pr

There are no specific blogs for G5pr, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our G5pr Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol PPP2R3C