G0S2 Antibody

Images

 
Western Blot: G0S2 Antibody [NBP1-86112] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human plasma (IgG/HSA depleted)
Immunohistochemistry-Paraffin: G0S2 Antibody [NBP1-86112] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferus ducts(spermatids and spermatozoa).

Product Details

Summary
Product Discontinued
View other related G0S2 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-86112
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

G0S2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PFTAARRLRDQEAAVAELQAALERQALQKQALQEKGKQQDTVLGGRALSNRQHA
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
G0S2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin: HIER pH 6 retrieval is recommended.

The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Theoretical MW
11 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publications using
NBP1-86112 in the following applications:

  • 1 publication
  • WB
    1 publication

Reactivity Notes

Mouse reactivity reported in scientific literature (PMID: 23878361).

Alternate Names for G0S2 Antibody

  • G0/G1 switch regulatory protein 2
  • G0/G1switch 2
  • RP1-28O10.2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-41536
Species: Hu, Mu
Applications: WB, ICC/IF
NB110-41576
Species: Hu, Mu, Rt
Applications: WB, Simple Western
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NB110-37253
Species: Hu, Mu, Rt
Applications: WB
NBP1-61399
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-40760
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
A-101
Species: Multi
Applications: WB, ICC
NBP1-49311
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NBP1-33480
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NB100-56098
Species: Hu, Mu, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-84313
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56745
Species: Hu, Mu
Applications: WB, ChIP, ICC/IF, IP

Publications for G0S2 Antibody (NBP1-86112)(2)

We have publications tested in 2 confirmed species: Human, Mouse.

We have publications tested in 2 applications: IHC-P, WB.


Filter By Application
IHC-P
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
Mouse
(1)
All Species

Reviews for G0S2 Antibody (NBP1-86112) (0)

There are no reviews for G0S2 Antibody (NBP1-86112). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for G0S2 Antibody (NBP1-86112) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional G0S2 Antibody Products

Related Products by Gene

Bioinformatics Tool for G0S2 Antibody (NBP1-86112)

Discover related pathways, diseases and genes to G0S2 Antibody (NBP1-86112). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for G0S2 Antibody (NBP1-86112)

Discover more about diseases related to G0S2 Antibody (NBP1-86112).
 

Pathways for G0S2 Antibody (NBP1-86112)

View related products by pathway.

PTMs for G0S2 Antibody (NBP1-86112)

Learn more about PTMs related to G0S2 Antibody (NBP1-86112).
 

Research Areas for G0S2 Antibody (NBP1-86112)

Find related products by research area.

Blogs on G0S2

There are no specific blogs for G0S2, but you can read our latest blog posts.

Contact Information

Product PDFs

Review this Product

Be the first to review our G0S2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol G0S2
Entrez
Uniprot