FZR1/CDH1 Antibody


Western Blot: CDH1 Antibody [NBP1-69013] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Product Details

Product Discontinued
View other related FZR1/CDH1 Primary Antibodies

Order Details

    • Catalog Number
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FZR1/CDH1 Antibody Summary

Synthetic peptides corresponding to Fzr1 (fizzy/cell division cycle 20 related 1 (Drosophila)) The peptide sequence was selected from the N terminal of Fzr1. Peptide sequence RQIIIQNENTVPCVSEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVN.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Fzr1 and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FZR1/CDH1 Antibody

  • CDC20C
  • CDH1
  • Cdh1/Hct1 homolog
  • CDH1CDC20-like 1b
  • fizzy/cell division cycle 20 related 1 (Drosophila)
  • Fzr
  • FZR2
  • FZRCDC20-like protein 1
  • hCDH1
  • KIAA1242fizzy-related protein homolog


Fzr1 is the key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Fzr1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, PLA
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, Simple Western, IHC
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, IHC
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Mu
Applications: WB

Publications for FZR1/CDH1 Antibody (NBP1-69013) (0)

There are no publications for FZR1/CDH1 Antibody (NBP1-69013).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FZR1/CDH1 Antibody (NBP1-69013) (0)

There are no reviews for FZR1/CDH1 Antibody (NBP1-69013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FZR1/CDH1 Antibody (NBP1-69013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional FZR1/CDH1 Products

Bioinformatics Tool for FZR1/CDH1 Antibody (NBP1-69013)

Discover related pathways, diseases and genes to FZR1/CDH1 Antibody (NBP1-69013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FZR1/CDH1 Antibody (NBP1-69013)

Discover more about diseases related to FZR1/CDH1 Antibody (NBP1-69013).

Pathways for FZR1/CDH1 Antibody (NBP1-69013)

View related products by pathway.

PTMs for FZR1/CDH1 Antibody (NBP1-69013)

Learn more about PTMs related to FZR1/CDH1 Antibody (NBP1-69013).

Blogs on FZR1/CDH1

There are no specific blogs for FZR1/CDH1, but you can read our latest blog posts.

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our FZR1/CDH1 Antibody and receive a gift card or discount.


Gene Symbol FZR1