FZR1/CDH1 Antibody

Images

 
Western Blot: CDH1 Antibody [NBP1-69013] - Titration: 0.2-1 ug/ml, Positive Control: Mouse Heart.

Product Details

Summary
Product Discontinued
View other related FZR1/CDH1 Primary Antibodies

Order Details


    • Catalog Number
      NBP1-69013
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

FZR1/CDH1 Antibody Summary

Immunogen
Synthetic peptides corresponding to Fzr1 (fizzy/cell division cycle 20 related 1 (Drosophila)) The peptide sequence was selected from the N terminal of Fzr1. Peptide sequence RQIIIQNENTVPCVSEMRRTLTPANSPVSSPSKHGDRFIPSRAGANWSVN.
Clonality
Polyclonal
Host
Rabbit
Gene
FZR1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against Fzr1 and was validated on Western blot.
Theoretical MW
55 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for FZR1/CDH1 Antibody

  • CDC20C
  • CDH1
  • Cdh1/Hct1 homolog
  • CDH1CDC20-like 1b
  • fizzy/cell division cycle 20 related 1 (Drosophila)
  • Fzr
  • FZR2
  • FZRCDC20-like protein 1
  • hCDH1
  • HCDHFYR
  • KIAA1242fizzy-related protein homolog

Background

Fzr1 is the key regulator of ligase activity of the anaphase promoting complex/cyclosome (APC/C), which confers substrate specificity upon the complex. Fzr1 associates with the APC/C in late mitosis, in replacement of CDC20, and activates the APC/C during anaphase and telophase. The APC/C remains active in degrading substrates to ensure that positive regulators of the cell cycle do not accumulate prematurely. At the G1/S transition FZR1 is phosphorylated, leading to its dissociation from the APC/C. Following DNA damage, it is required for the G2 DNA damage checkpoint: its dephosphorylation and reassociation with the APC/C leads to the ubiquitination of PLK1, preventing entry into mitosis.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-91662
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF4885
Species: Mu
Applications: WB, IP
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-59828
Species: Hu, Mu
Applications: WB, IHC-P, IP, PLA
NBP2-03644
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NB100-56552
Species: Hu
Applications: WB
NBP2-30083
Species: Hu, Mu
Applications: WB, ICC/IF, IHC-P
NB100-168
Species: Hu, Mu(-)
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, Flow-IC
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP2-20287
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-59068
Species: Hu
Applications: WB
NBP1-81988
Species: Hu
Applications: IHC, IHC-P
NBP2-21037
Species: Hu
Applications: WB, IHC, IHC-P
AF3264
Species: Hu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-69013
Species: Mu
Applications: WB

Publications for FZR1/CDH1 Antibody (NBP1-69013) (0)

There are no publications for FZR1/CDH1 Antibody (NBP1-69013).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FZR1/CDH1 Antibody (NBP1-69013) (0)

There are no reviews for FZR1/CDH1 Antibody (NBP1-69013). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FZR1/CDH1 Antibody (NBP1-69013) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FZR1/CDH1 Products

Bioinformatics Tool for FZR1/CDH1 Antibody (NBP1-69013)

Discover related pathways, diseases and genes to FZR1/CDH1 Antibody (NBP1-69013). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FZR1/CDH1 Antibody (NBP1-69013)

Discover more about diseases related to FZR1/CDH1 Antibody (NBP1-69013).
 

Pathways for FZR1/CDH1 Antibody (NBP1-69013)

View related products by pathway.

PTMs for FZR1/CDH1 Antibody (NBP1-69013)

Learn more about PTMs related to FZR1/CDH1 Antibody (NBP1-69013).

Blogs on FZR1/CDH1

There are no specific blogs for FZR1/CDH1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FZR1/CDH1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FZR1
Uniprot