Fyn Antibody (1A3)

Images

 
Western Blot: Fyn Antibody (1A3) [H00002534-M03] - Detection against Immunogen (35.64 KDa).

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
1A3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Fyn Antibody (1A3) Summary

Immunogen
FYN (AAH32496, 1 a.a. - 90 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MGCVQCKDKEATKLTEERDGSLNQSSGYRYGTDPTPQHYPSFGVTSIPNYNNFHAAGGQGLTVFGGVNSSSHTGTLRTRGGTGVTLFVAL
Localization
Cytoplasmic
Specificity
FYN - FYN oncogene related to SRC, FGR, YES
Isotype
IgG2b Kappa
Clonality
Monoclonal
Host
Mouse
Gene
FYN
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Fyn Antibody (1A3)

  • EC 2.7.10
  • EC 2.7.10.2
  • FYN oncogene related to SRC, FGR, YES
  • Fyn
  • MGC45350
  • OKT3-induced calcium influx regulator
  • p59-Fyn
  • protein-tyrosine kinase fyn
  • Proto-oncogene c-Fyn
  • Proto-oncogene Syn
  • proto-oncogene tyrosine-protein kinase fyn
  • SLK
  • SLKc-syn protooncogene
  • src/yes-related novel
  • Src-like kinase
  • SYN
  • tyrosine kinase p59fyn(T)
  • tyrosine-protein kinase Fyn

Background

This gene is a member of the protein-tyrosine kinase oncogene family. It encodes a membrane-associated tyrosine kinase that has been implicated in the control of cell growth. The protein associates with the p85 subunit of phosphatidylinositol 3-kinase and interacts with the fyn-binding protein. Alternatively spliced transcript variants encoding distinct isoforms exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2685
Species: Hu
Applications: WB, Simple Western, IHC
MAB7500
Species: Hu
Applications: WB, ICC
NB500-519
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91228
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB110-60490
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP2-24867
Species: Hu, Mu
Applications: Flow, Func, In vitro, In vivo, CyTOF-ready, Flow-CS
NB300-653
Species: Hu, Mu, Rt, Ch, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-32945
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP1-85951
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB32051
Species: Hu, Mu, Rt
Applications: WB, IHC
NB110-58870
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF
H00002534-M03
Species: Hu
Applications: WB, ELISA

Publications for Fyn Antibody (H00002534-M03) (0)

There are no publications for Fyn Antibody (H00002534-M03).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Fyn Antibody (H00002534-M03) (0)

There are no reviews for Fyn Antibody (H00002534-M03). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Fyn Antibody (H00002534-M03) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Fyn Products

Bioinformatics Tool for Fyn Antibody (H00002534-M03)

Discover related pathways, diseases and genes to Fyn Antibody (H00002534-M03). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Fyn Antibody (H00002534-M03)

Discover more about diseases related to Fyn Antibody (H00002534-M03).
 

Pathways for Fyn Antibody (H00002534-M03)

View related products by pathway.

PTMs for Fyn Antibody (H00002534-M03)

Learn more about PTMs related to Fyn Antibody (H00002534-M03).
 

Research Areas for Fyn Antibody (H00002534-M03)

Find related products by research area.

Blogs on Fyn

There are no specific blogs for Fyn, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Fyn Antibody (1A3) and receive a gift card or discount.

Bioinformatics

Gene Symbol FYN
Entrez
OMIM
Uniprot